SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182XYV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182XYV8
Domain Number 1 Region: 509-671
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 8.11e-69
Family A middle domain of Talin 1 0.0000168
Further Details:      
 
Domain Number 2 Region: 678-801
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.89e-52
Family I/LWEQ domain 0.0000443
Further Details:      
 
Domain Number 3 Region: 2341-2530
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.59e-51
Family I/LWEQ domain 0.00016
Further Details:      
 
Domain Number 4 Region: 771-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.92e-47
Family I/LWEQ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1854-1984
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.88e-32
Family VBS domain 0.00043
Further Details:      
 
Domain Number 6 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.88e-31
Family alpha-catenin/vinculin 0.062
Further Details:      
 
Domain Number 7 Region: 205-319
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-31
Family Second domain of FERM 0.00000657
Further Details:      
 
Domain Number 8 Region: 320-410
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-25
Family Third domain of FERM 0.0000465
Further Details:      
 
Domain Number 9 Region: 1479-1562
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000157
Family I/LWEQ domain 0.01
Further Details:      
 
Domain Number 10 Region: 963-1061
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000569
Family I/LWEQ domain 0.0034
Further Details:      
 
Domain Number 11 Region: 1596-1667
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000314
Family VBS domain 0.054
Further Details:      
 
Domain Number 12 Region: 2021-2137
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000487
Family VBS domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182XYV8
Sequence length 2757
Comment (tr|A0A182XYV8|A0A182XYV8_ANOST) Uncharacterized protein {ECO:0000313|VectorBase:ASTEI01394-PA} KW=Complete proteome; Reference proteome OX=30069 OS=Anopheles stephensi (Indo-Pakistan malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSTLSLRISLEGGRVTKTIQFDPSTTVFDACRIIKDKFAEAVQGQAQEFGLFLADDDTRQ
GVWLEPARNLGYYMLHNHDVLEYRQKHRTLRVRMLDGAVKTILVDDSLPVSQLMVVICTK
IGITNHEEYGLVREDPEAQNENQPDNRSNTGTLTLRRKAQEKERDAKMESLRKKLRTDDE
INWVDVGKTLREQGIDEQETVLLRRKFFYSDQNIDSRDPVQLNLLYVQARDAILDGTHPV
TQDKACEFAGIQVQIQFGDHNEAKHKTGFLDLREFLPASYVRTKNIERKIFAEHRKLIGL
SELDAKYVYTKTARELPTYGVTFFLVKEKMTGKNKLVPRLLGVTKDSVLRLDETTKEIMK
SWPLTTVRRWGASPNTFTLDFGDYADSYYSVQTTEAEQIVQLIAGYIDIILKKKQAKDHF
GIEGDEGSTMVEESVAPSKATFLQHEETNKSGKVETHSIAKPAIMRGTDGERPYGTGEMQ
SIQYGAIVGQVNLAHQPPMLQQTRISSVLSEPQRALLGYISAGQEALNRAEKDLETKVQL
PPLGTDPGSLQWREETLDTSKQTVTTHLATMNAATAQVVTASQPDEIDHEAVGAAVSQIT
QSIPEVTKEVRLIAALMDDDCTGDKLLEATRKLCNAFSDLLRSAEPESKEPRQNLLNAAT
RVGEASGQVLSTIGEESVESRELHDMLLGLAKAVANTTAALVLKAKSIAAVTEDEATRNK
VIGAASQCALATSQLVACARVVGPTIQSPACREQLEAAAREVAKAVAHLAEVCNEATDNQ
QLRGDLTAAAKDVSKSLTDLLEHIKLSAREKARRVENENPVDNVLVATDILVSSSDPQEM
IRQAQQLGKATAQLIESIKGEAESQHDSNMQRKLLEAAKQLADATARMVEAARLCAGNPH
DSAHQETLRAAAEELRVITTSTANTPAIKRQLIGRLEQCAKQAASSATQCITAAQNSLIH
SNDVQTKEILLQDCQAVADQIPRLVAGVKNTLSRPDDPNAQLGLIDAAEMFLEPGAQMAG
SARELQPTVMDQAASQQLGRCAVNLTHAIHDLRQAAHRAREACGGNELDAALEAVRNLRN
VLSDTRRAAQEGSLRPLPGETADSCFKQLAAASNSVDVSMHQLMSAAQQGNRTYAGVAGR
DTALALGDYTKSVRGVLVTTKNPAVVDCADEVIVDSLRVIEEAQRTLQNLDNQEALLIAI
KRTKHSLGRTIDCLPGVKDINEAFDTVTDLRGILDTGEYPPSDRPYGQLQNELKSAADQL
NVAGGQVAQSYDSSIKLAGTSQEFCHAYKELLTVTLEMAGQTAEDRAREEIVNSLRGVSN
QSISLLGTARYVAGDPDRPNAKNELSSAARLVTESINRLVDVCTQAAPGQKECDGAIRSI
ESLRPLLESPQESLTDQGYFDCLDTVLEKSRTLGEGMTGIANNAKNSKHVEFGHSVNSVS
DSIRGLIESAAQAAYLVGVSNPTSVGGRPGIVDQAQYARAAQAIRQSCDILRGQASSQPQ
VLSAATVIAKHTSALCNACRNASSTTTNPVAKRHFVQAAKEVANSTAALVREIKALDQDY
SPASRQRCAAATEPLLEAVSSLCHFASSPEFISIPARISTEGRKAQEPILTAGRGILDGA
VDMVRTAKVLALTPTDPPVWQQLATHSRNVSDSIKQLASSIREKAPGQMQCDQVLEVLKD
CSRELNSAALAVGVDGLPQRKDSNLQGFTNQSLNAASELIDRLEPVKSSAKKNAESLGHA
VNQIAKHIVPLTNGVIGACSQLVHSGQQTVLINQVKSVVECCAQLVQTAKQAGGNPRAAH
FHPELDEAVESTREAIQELNATVERLSTENGVVTGLMEQISRSMSRISDKRQSFLGASLN
DTYVDYQTRMVQSAKEIARYANEINAKAAIDPSKLAQLCVEMTHHYTQLAQDAIGASALT
TSPDVAIRIRNTVQDLGRSVNVLIQSTTGIRKDDSSGLVEISRGARDVSEKVAQVLAALQ
AGSRGTQACINASSTVSAIISDLDTTIMFATAGTLQSSDEDGKFSDHREHILKTAKALVE
DTKILVAGAAGTQDQLAAAAQNAVTTILQLADAVKHGAASLGSGQPDSQVMVINAVKDVA
AALGELINATKLASGKPINDPAMNDLKDSAKMTDPDIGNSAACWWLSDQEEELLRLLSNV
PTLFDGVMVMNVTSLLKTVKAVEDEHTRGTRAMEATVDAISQELRSMQFAPEMMRSSMQQ
LSRPEDLISVTKHVTAATAKAVAAGASNLQADIAAAANLGRKTISDMLSVCRSVAWSCAE
TQDLRQRTLDAGSAVAIAYRELLEGILHHCTADERMQLSRRVAMCVTDLVGMAQLLKGSD
WVDPDDPTVIAENELLGAAASIEAAAKKLANLRPRRQEVKEADENLNFDEMILEAAKSIM
AASSSLVRAANAAQRELIDQGKVAKRPLTSSDDGQWSEGLISAARLVAAATHSLVEAAQN
LVQGVGTEEMLISSAKQVASSTAQLLIACKVKSDPNSETGRRLQAAGNAVIKSTDKLVQA
AQQAIEGEEEHTLRLNRNMVDGMAQEINARSEILMRERQLEEAKNKLIAIRHAKYRQKLG
GGFTTDESDEGGVAPPPFAGYGQSTSPKPPQTLPKPGTYSPSSFGGVSPGQGASTMPRLG
QQSASPASPSFQRPGSGNQLLTANAVPKPYQSDALKSPSALVSPSMLNRSYDMTRVENTN
LSASKFNRTQFDAAVQDLQNKVQPLSTFRSSPTHPHTNGGVAGSSPAPQTYEGFTTR
Download sequence
Identical sequences A0A182XYV8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]