SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183J141 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183J141
Domain Number 1 Region: 173-264
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 8.5e-28
Family Small-conductance potassium channel 0.0001
Further Details:      
 
Domain Number 2 Region: 43-213
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-25
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183J141
Sequence length 306
Comment (tr|A0A183J141|A0A183J141_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:SBAD_0000993701-mRNA-1} KW=Complete proteome; Reference proteome OX=241478 OS=Soboliphyme baturini. GN= OC=Dioctophymatida; Dioctophymatoidea; Soboliphymatidae; Soboliphyme.
Sequence
MFELTRQFLVKIFIDWHVISEDRYTVRTIPISINIILSSFVFLRLYLLCRFMALHSKQFQ
DAATRSIAALNRITVDFDFVLKTMISEHPIRVLLLFTGILWIVMAWLFCQCERYNGQNEG
YLFTNSIWFIIITFLSVGYGDVTPRTFCGRGVALTTGILGAGVSSALIAVISRHMELTRA
EKQVNNFMSDTKLEKQRKDVAAKVLQYRWFIHKYCGSKRSIDRAKLRNYQRKFLTAINEF
KHVKWEQRKTAEEGNALMDLAKMQRVMHESLFDAKKQQESIINRLEVLNKSVQNLQHAMT
LMNINS
Download sequence
Identical sequences A0A183J141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]