SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183KQ24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183KQ24
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-35
Family Ankyrin repeat 0.00072
Further Details:      
 
Domain Number 2 Region: 297-339
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000798
Family SOCS box-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A183KQ24
Sequence length 371
Comment (tr|A0A183KQ24|A0A183KQ24_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SCUD_0001716101-mRNA-1} KW=Complete proteome; Reference proteome OX=6186 OS=Schistosoma curassoni. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MKAARSGKVWAVRRLLLFGANVNVKDRNDETALHFACRQGSTEITRMLIKAESRLNAQNQ
IGLTPLMESVSYNQREAVSLLIKHKDIDLYKRDFCTGDTALHIAVKKNYIHIVEILLRAG
NWYIEYNYNNLGESFVHDVVAYNRLELLRLFLAYNYDLDRPAKRLPPNIHLLSSLNHQTL
LKNTQNTITTSMIQSESNNRTSINSFEKSPFKMALERGHLDMARILAEVGCFCTHLPINS
NSIPSVCTTSSSSSSSSASSSSNNNNIPETNTINSTVKNSHFINQNLLTRRYNGLLEVKS
LQKWCRKVIRQRLGFRLIEALPLLPIPVPLKDFLLLRDIDWSIYLNNIHNNNSNNRSSII
NSGELAIIVPT
Download sequence
Identical sequences A0A183KQ24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]