SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183MJN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183MJN9
Domain Number 1 Region: 12-273
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.13e-59
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 246-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000829
Family Ankyrin repeat 0.005
Further Details:      
 
Domain Number 3 Region: 449-491
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000131
Family SOCS box-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A183MJN9
Sequence length 526
Comment (tr|A0A183MJN9|A0A183MJN9_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SMRZ_0001626501-mRNA-1} KW=Complete proteome; Reference proteome OX=48269 OS=Schistosoma margrebowiei. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MASNTTIPGLAFYDSLINNNISESKRLVEIHKIDINARLSHVRKRNHTDLCPVHLVAYKG
NLAMLHYLIQNGVNVHQPTCTLQRRPVHYAALRQQVSCLQMLLNAGAQIDARDTFGNTPL
HYAAEDGDGGLLSLLLNNGACVDAQDITNKTPLMKAARSGKVWAVRRLLLFGANVNVKDR
NDETALHFACRQGSTEITRMLIKAESRLNAQNQIGLTPLMESVSYNQREAVSLLIKHKDI
DLYKRDFCTGDTALHIAVKKNYIHIVEILLRAGNWYIEYNYNNLGESFVHDVVAYNRLEL
LRLFLAYNYDLDRPAKRLPPNIHLLSSSNHQTLLKNTQNTITPSMTQSESNNRTSINPFE
KSPFKMALERGHLDMARILAEVGCFCTHLPINSNSIPSVCATSSSSSSSSASSSSNNNIP
EPNTINSTVKNSHFINQNLLTRRYNGLLEVKSLQKWCRKVIRQRLGFRLIEALPLLPIPV
PLKDFLLLRDIDWSIYLNNIHNNINNNSNNRSSIINSGELAVIVPT
Download sequence
Identical sequences A0A183MJN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]