SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183QYC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183QYC4
Domain Number 1 Region: 5-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.66e-57
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 210-278,322-346
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000101
Family Ankyrin repeat 0.0054
Further Details:      
 
Domain Number 3 Region: 415-457
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000458
Family SOCS box-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183QYC4
Sequence length 491
Comment (tr|A0A183QYC4|A0A183QYC4_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SROB_0000869301-mRNA-1} KW=Complete proteome; Reference proteome OX=6188 OS=Schistosoma rodhaini. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MLVRKRNHTDLCPVHLVAYKGNLAMLHYLIQNGVNVHQPTCTLQRRPVHYAALRQQVSCL
QMLLNAGAQIDARDTFGNTPLHYAAEDGDGGLLSLLLNNGACVDAQDITNKTPLMKAARS
GKVWAVRRLLLFGANVNVKDRNDETALHYACRQGSTEITRMLIKAESRLNAQNQIGLTPL
MESVSYNQREAVSLLIKHKDIDLYKRDFCTGDTALHIAVKKNYIHIVEILLRAGNWYIEY
NYNNLGESFVHDVVAYNRLELLRLFLAYNYDLDRPAKRLPLNIHLLTSSLNHSMITKTTQ
TTITPSIIQSESNSRTVINPFEKSPFKMALERGHLDMARILADVGCFCTHLPIHSNSISS
GCASSSSSSSSSTSASSSSSSSNNVTDTNTIHSTMKNSHLIHQNLLTRRYNGLLEVKSLQ
KWCRKVIRQHLGFRLIESLPLLPIPVSLKDFLLLRDIDWSIYLNGNNHNHNHNTNRSSII
NSGELAIIVPT
Download sequence
Identical sequences A0A183QYC4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]