SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZ15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZ15
Domain Number 1 Region: 765-782,854-904,945-1051,1097-1272
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.11e-71
Family Duffy binding domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1-214,246-262,310-330
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.85e-54
Family Duffy binding domain 0.0004
Further Details:      
 
Domain Number 3 Region: 1263-1479
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.79e-35
Family Duffy binding domain 0.0028
Further Details:      
 
Domain Number 4 Region: 346-390,422-439,466-587,627-647
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-34
Family Duffy binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A191VZ15
Sequence length 1641
Comment (tr|A0A191VZ15|A0A191VZ15_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ20952.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIIRGKDLYIRNKQEKENLEKNLRKIFKKIYHNLTDHKAKGYYNDDTDNNFYQLREDWWE
LNRREVWKAITCNAQGSQYFRGTCSNDTTLAKGHCQCIDGTVPTNFDYVPQYLRWFEEWA
EDFCRKKKKYVGIVKTYCREKDKNNQDRYCSRNGYDCEKTKRAVGKLRYGKQCISCLYAC
NPYVDWINNQKEQFLKQKKKYADEIKIYTNEASGSSGGSSRQKRGTTTKYDGYEKIFYAK
LKAGNYGTVGEFLEKLSKEKACKEVKDGGTIDFKQVNSTSGGTAVSASGASSTSGGSGAA
SGGTSDTSGTNDASQGTFYRSEYCQPCPDCGVKKKSDATSGKKWEEKNDKCNIKLYEPTD
DAKPTNITILKSGEGKEEIENKLNAFCDEKKNDTPNSNGISVASGGVVGGRGGASHGEGK
KSDKDSLYEEWKCYKHEHVQKVKDDKNGEEEDEEEEDKDEVKEGGGLCILKNEKHVSAKN
SSNEPDQFQKTFHDFFYYWVAHMLKDSIHWKKKLEKCLKNGTKTRCKNNKCNRECGCFLQ
WVQQKKKNEWEKIVEHFKTQDFGKQDGLLGHFGYDFVLKGILEKDELLSSIKEGYGNAKE
TEGIRKILEEEKKREEEDPAAAIAVGENNTTIDKILQHEEEIATKCLQKCQETQKPSPGG
GAAGDRDVGRSAGTSPDIPSRAEEEEEEEEDEEEEEEVEDVSNHQDNNEVEAAKTVEEVK
EHTETPQKDTEKEVPPTPTTDTSVEVCKTVADIFSDPSNFKDVACNLKYAKNNSRLGWKC
IPTSGDKAATSEGSDTATGERAGRSKRDTDSSGESTRSSGDSTSGNDGAPGVKSGPTSDA
TTGVTTATSSDSNQGSICVPPRRRKLYLHKMEGDGEDITDDKSLREWFVKSAAVETFFLW
HRYKKQKEKKPQVVGSQLLTTPDGDSLTDDDENKNKDPQTELNSGKIPDGFLRQMFYTLG
DYRDILVRGGSNTNGDTKDANNIILNASGNKEDMEKIQEKIDEILSKQSGTPPPTPPGTP
PGKPSDKRVDWWDTNAQFIWHGMICALTYTEKKETGENGVKIEQNQELKGQLLENGKSTP
KNTQYQYSSVTISSVPSGEETPLDSFVKRPPYFRYLEEWGENFCKERKKRLAQIKVDCEV
NEEGNRGCSGDGLKCNEIVIDKEKIFGDFLCSTCARHCRSYRKWIERKKDEFNKQKSAYG
QQQKKYVNECNGSGRNNDNGFCKTLERCSKAAEFLERLKNGPCKVQNGEDNNKIFDENSE
TFKHTKHCDTCSKFKIKCNGNDNCTLDGTKVKCTGRTIFAKDIETLEQPTDINMLVSDNN
TNGFQNGLNECKDKGIFEGIRKDEWKCRNVCGVDICTLEKKNNNAEGKEHIIVKELIKRW
LEYFFEDYNRIQKKLKPYIENDKECTCQNKCNDKCNCASKWIDEKKEEWQKIKKTYLEQY
TKLNPEGNNLTNFLEGAPFRSEVDKAIKPCKELRNFESKQCNVTANSKSGEVKKKDIVEC
LFQKLQNKIDKCKVKHQTAENPETECEKSPAPVEDDDDTLHEEIEVKAPKICPPQTQPQP
EPADEETCKAAPAPVPAGPAPAPATSDETNQPPDQTPVLKPEEGTPPTVFDNPHLKTALV
TSTLAWSVGIGFATFTYFYLK
Download sequence
Identical sequences A0A191VZ15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]