SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZ17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZ17
Domain Number 1 Region: 1371-1479,1513-1598,1637-1805
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.26e-80
Family Duffy binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 586-936,974-993
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-76
Family Duffy binding domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1029-1375
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-73
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 4 Region: 2533-2890
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-62
Family Duffy binding domain 0.0000863
Further Details:      
 
Domain Number 5 Region: 2937-3204
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-51
Family Duffy binding domain 0.0000681
Further Details:      
 
Domain Number 6 Region: 1-277
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-47
Family Duffy binding domain 0.00065
Further Details:      
 
Domain Number 7 Region: 2145-2449
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-47
Family Duffy binding domain 0.00031
Further Details:      
 
Domain Number 8 Region: 1799-2011
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-34
Family Duffy binding domain 0.0035
Further Details:      
 
Domain Number 9 Region: 268-477
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.55e-28
Family Duffy binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A191VZ17
Sequence length 3266
Comment (tr|A0A191VZ17|A0A191VZ17_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ20955.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIVRGRDMFKSNDNVEKGLKAVFRKINNDLEKKKINNYDEDGPEYYKLREAWWTANRDQV
WKALTCTAPDKANYFIYKSDSLLNFSSDRCGHNNNDGPPTNLDYVPQFLRWFDEWAEEFC
RKRKIKLEKIKNACYNKQKEIYCSHNGYDCIKMSWKKDIEFRENYCTGCFSACSLYKIWI
GKQKEEFEKQKEKYKNEIQKYVSETVRSNSNINEEYYKEFYKKLKDENYHTHENFLNFLK
EGKYCKESVKDENNIDFNSGVDNTFSHSKDCKVCPYCGLDCVGTECTAKPEIYPDCVYNG
AYDPPNGAESTEITVLYNDNEGDMSKKLSEFCSKVNKEDGENYQKWKCYYTNSEDIDCEM
TSISQKDQKISDVKTFYNFFDLWVKNLLRDSIKWETELKGCINNTNVTDCKSVCNVNCEC
FDKWVKQKEKEWDSIKKLLKKKKNVSKKYYTNINKNFDIFFFRVMYELNNEEAKWNKLME
NLRTKINSYKKNKRTKDSEGAIKVLFDHLKETATICKDNNTNEACVSSQNATTNPCAKSR
DYNKHATVKQIAQYYKRKAYIQLNERAGRSALKGDATKGKYMSSLSEKRLYEICKITKDN
SNAKREFSKHPCAGKDREKKLFELKDVWKTGTDVQMSHKDVFMPPRRQHFCTSNLEFLDT
DYIPFIYYGAKVINDSFLGDVLLSAKSEADKIIDMYKEKNKLNGPKDPKEPKDPNDQETI
CRAIRYSFADLGDIIKGTDLWDKDSGEERTQRRLETVFGKIKKQFNGKYTHEEAKPPYRQ
LRADWWEANRDKVWEAMKCEISKLKDESVDESKSHCGYSDHTPLDDYVPQRLRWMTEWAE
WYCKMQKEEYDKVQQSCEKCNVADGKCTQGNGECANCATKCKQYAQNVKKWEDQWKEIKQ
KYYELYQKATQNDDTSSNKDVDVVKFLSELYKANNVKSGANSDMYGTAAGYVHQEVSHMN
CKEQKIFCDNTTSGNNKNYAFEPYPYDYKDKCNCKDDTRPQEKKKDDVCDMVKALIGRND
GNNSIGVCHPKNRDKKYPEWKCGDQSLVIDINTCMPPRRQKLCLYFVAHHNETPKINSPD
HLREAFIKCAAAETFLSWQYYKSKHGNGASKLDEELKKGTIPPEFLRSMFYTYADYRDIC
LDTDISKKQNYVLKAQTKIDQIFPKINEQTPDEERKSWWTKHGPEVWEAMLCALEKASGT
TGTLTTKYTYSTVTFSDNKTTLQEFAQRPQFFRWLTEWGEDFCKKRGEKVNELVQGCEKC
TLGTDGKICEKNSEGCIKCAQECKEYEDWLKDWKQHYDKQKDKFKTDKTTYYDAKDSDHA
YEYLKKQLTNIPCTNGTINGKCVYKCMDDKSISSTDDMPKSLDNEPQEVQGRCSCTPPPK
ACEIVQNIFDDKTGTHFIDACRLKYENGKELFTQWYCKTDSPSTTPPSPSPTSTCIPPRR
QKLYVKPIESLGGTSTVDLRTAFIQSAAVETYFAWHKYKKDKEREDKEQNEETLYRVEQT
TLDAKAQNELDDGTIPEDFKRQMFYTFGDYRDILIGKDMSNGKDMDSIKRNINMVFEKSG
PKLSSAEKTPIEEQRKQWWNSNAKAIWEGMLCALSHDTKERTFKDEVHKKLTEHEKNKNT
YGNVTITSVGLSGDNTVTDLSKFSEKPQFIRWLEEWGEEFCRKRTYKLEKIEKECRRDNG
GRYCDGDGFECTEIGPSKKENITTFNCPSCGKSCRSYEQWINKKKDEFDKHKEKYRKEID
DHKSNSGNTYNKEFYTTLKGKYNTSTEFLQTLKRQYSNNNTEDSKIDFRKPNDTFKHAKN
CAPCPVFGVECKGYVCSGAKEKKCNRKTFKDTDDIKNMEKLIEKGHMLVIDNSENTLPDD
LNSVCDNTTIFNGIRNDEWSCAYACDYDVCELKTFKGDIYHKGNIKIRTLFKRWIENFLN
DYNKIKEHLNPCMNNGKQTICTKGCGKNCECLQKWAEEKMTEWKKVRELYFKQYSGNNIE
EVYEVNRFLGDLKPQTEVKKAIKPCKYINQLQDSKECIEPHLSGNKESTNKDVIEILIEK
LQKKIDECKNQLDENPPNCDESLSPGDDETLDPPEEDTLDHKQSPEFCPNNIPEPAKPKS
DSDILCDDNKQPKCDGFKTYNTNTFEPKKNLIGLGAQYHKAGRFYPNVYISPRVNQLCLK
PLKELENSNEHMVDKSKLINVLTKCAYNEAKGLYKYYNDNKKTFENNGSTLSEKEITTYI
LEAMERSYADYGSIVKGDILWDYEDRKKIDEKIMNFAEKHNTSIEESRLAILDDDDVKRQ
KLWESIRTDVWKSMLCGHKDAIGGDTNSLSNGLDFCKLPTTDEEYPFLRWFVEWGQNFCI
RRDQELKYLKKQCQNVMCNDSDESKKQACQTLCKKYQEFLINSKIQYETQKPEYDNLMSS
IPKHRKKDAIEFLKEKCNAGFSCFKDVNENEHNKIFQYPSDEVKNLCTCTSTDTSKTTPT
NCIEKAAYELQQKITKNIGNNSNNLKGYEVALFECRKGDHVVVDNNDFTKTIDKDKLNQY
FPPNKYSCEPKEFNSFHVGKEWDCNNRNINLRDKNLCLPPRRQFMCMKKIEHISAKDVKD
KKKLLQEVMEIAKEEGIRILRNYQEQNKTDFSEICDDMKYSFADLGDIIRGTDLWKVYPN
YHTTERNLQNIFNNIHYNITEGGSKDKYKYDGRYFHELRNDWWNTNREAIWKAMTCCAPR
SAYIYKKTNTGENIRSTDMYYYCGYTKEPPYDDYIPQRLRWMKEWGEYVCKTLNEKINDI
KKECDKCKLNDRNCSIENDGNKCTNCKEKCREYTKLIQNLKSELDIQQEIYKELYTKIID
NGIRFTTDSDKEVIEFLKEVEKTGCDVKSFDKYLDKTSHCINYKFNEKEKEKETYAFNLN
SNVFKEKCKCGITKDPLDKCPDKNTCTKYNSIKCFRKKHDDNAYWESTFVKDDKITIKKI
LVPPRRKNICLRIDESKFLRLRKEIKNFKNFICSSAFSETKRLKQVYKDDNNKLLQAMKY
SFADIGNVVKGDDMMESPTNDYISKIFKGTKYSKTDGKTWWNENKYDIWESMLCAYKEAG
GDTSNNQNCRFPSIESVSQFIRWFQEWTENFCTRRKELYDEVQNTCQSATCKTDGKIDKT
ECTEACEKYNNYILSKKIEYEIQKNKYDLEFKSIYHSKEAYEYFKEECNGKCECLSNHID
DDKKWKEPYESFDDSSYKSKCDCQKAQPIKPAQEDKKPEDSFPTKPNDLPPLRPSQPSDN
TSDILARTIPFGIALALGSIAFLFMK
Download sequence
Identical sequences A0A191VZ17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]