SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZ31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZ31
Domain Number 1 Region: 702-751,782-854,902-1006,1074-1233
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-76
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1-224,256-272,308-328
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-47
Family Duffy binding domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1230-1447
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-37
Family Duffy binding domain 0.0061
Further Details:      
 
Domain Number 4 Region: 338-569,609-629
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-35
Family Duffy binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A191VZ31
Sequence length 1620
Comment (tr|A0A191VZ31|A0A191VZ31_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ20974.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIVRGKDLYSGITKKKKQRKQLDDNLKTIFDKIKKSDNKLTSLKDDQIREYWWALNRQDV
WKAITCGTHKGDTYFRPTCSDSERSGTLSQANNYCRCNDDNPDDDKPNIDPPTYFDYVPQ
YLRWFEEWAEDFCRKKKKYVGIVKKYCREKYKSGNEPRYCSRNGYDCEQTINKIGKLVIG
KGCISCLYACNPYEKWIDNQRKQFLKQRGEYENVIKRKSSSDSGNGREKRAAGSSGNNSN
YDGYESKFYKILKIDYQNVEKFLEKLSNEEICKKINDEEEGKINFEKVNTGGTAGTSGAS
STSGASGTNDETKGTFYRSKYCQPCPECGVEREGDKGWKNKSDNEQCRIKLYRPINDEEC
TPINFLYSGEGEKDIETKLNEFCAPANGDTTNSGVNSVAGGAGGSGGNSDSKELYQYWKC
YQPEELTYGDQKGEINEVYNKRVQTGGGLCILKNKKHKRGNNSSNEPEQFQKTYNDFFNF
WVAHMLKDSIHWRTKRLSKCINNSNETKACKNGCNTKCGCFQKWVDQKKKTEWDAIKKHF
KKQKNMKDGFGNDIDPGIILDGVLEKDVLLESIKSGYGKPEDIKYIEALLDEEKKREEED
EATAIAGDENKNTIDKLLNHELTDAQKCIKKCEEQKKQKAQPAEDGAGRATDPSPAPPDN
VEEEEIDDDEDEEEVPDGEVEEKGSSEKTAKEEEKAEAVEEPPATDPSAEVCATVAEALK
DDKSLKEACNLKYVKGKNYGWRCIAPSGSGSTATREGGDRGGQSRAKREASGDTTSGSSE
KGSICVPPRRRKLYVTPLTKLTGDNTAASQGEKSPQVSTSETASSQAPNGDSLLLTAFVE
SAAIETFFLWHKYKEQWLAQKKAEQGQNGLLFGTTAVPGAAGGGAQQPGSVSDDPDKQLA
SGNIPTEFLRQMFYTLGDYRDICIGKTPDGIDTVSASGNTNGESDMQKIKKAIDEFLNKQ
SGNEAGGPASPSSKDPGQTTTKPEDWWKTNGQHIWHGMICALTYKDSEQKGGGGNPTVDE
QVKKAFFGENGTSNEPTKYKYTEAKLEEENNGPKPTGASPKPQTEASSTSDNTPPKLKDF
VVRPPYFRYLEEWGETFCRQRARMLKDVNDNCMDDSGTKQKYSGDGEDCEDIFNNEYNVL
PDLSSRCAKPCRSYKKWIERKKIEFTKQENAYNNQKENVQNNNGFYTRIQNCNEAKDFLQ
KLGLCKKDNGSSTVDFNKEGDTFQHTKHCNPCSQFKIDCQKAKCTSGGINEKCNVKKNGN
DYITASDIENGGNSTHKLDMLVSDNSKSGNGFNDLPECENANIFKGIRKDEWKCRNFCGY
VVCKPKNVNGEAKGKHIIQIRALVKRWVEYFFEDYNKIKHKISHRIKNGEISPCIKNCVE
KWVDQKRKEWKEITERFKDQYKNDNSDDYKLTSFLETLIPQIPVANVQNDVKKVIKLSKF
DNSCGCSADASAQKNDGHEDAIDCMLQKLEDKAKNCPGKRSGEPCPQTTSENPDDEDEQL
EEEIEVKAPNICPQLPKPQAEDEGKCEEDTVLPSPGPKDDSEKDEKKEENSEDTTAAEGE
ESGAPGSSGAPSPPEPAPAPAPHPQPPPPLPSDNTSDILKTTIPFGIALALTSIVFLYLK
Download sequence
Identical sequences A0A191VZ31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]