SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZ68
Domain Number 1 Region: 1505-1610,1649-1749,1806-1849,1879-1984
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-77
Family Duffy binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 684-1043,1094-1112
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-77
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 1120-1318,1347-1491
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-75
Family Duffy binding domain 0.0000594
Further Details:      
 
Domain Number 4 Region: 2732-2895,2923-3050,3078-3097
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-63
Family Duffy binding domain 0.0000313
Further Details:      
 
Domain Number 5 Region: 3125-3420
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-58
Family Duffy binding domain 0.00004
Further Details:      
 
Domain Number 6 Region: 1-296
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-54
Family Duffy binding domain 0.0007
Further Details:      
 
Domain Number 7 Region: 2336-2644
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-50
Family Duffy binding domain 0.00043
Further Details:      
 
Domain Number 8 Region: 2039-2213
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-35
Family Duffy binding domain 0.0026
Further Details:      
 
Domain Number 9 Region: 287-539
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-33
Family Duffy binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A191VZ68
Sequence length 3462
Comment (tr|A0A191VZ68|A0A191VZ68_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ21002.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIVRGRDLFYGNTQEKEKRDELEKKLKEIFKQIHGGLTVGAQKHYEGDDNYYQLREDWWI
ANRDQVWEAITCNAGSGNRYFRQTACNGGKSSTQGKCRCEGANANQVPTYFDYVPQYLRW
FEEWAEDFCTKRKHKLENAKNKCRGKYKGADRYCSRNGYDCEKTKRAVGKYRMGKQCISC
LYACNPYVEWIDNQRKQFDKQKKKYDEEINGTSTSSRKKRAAGKSNYDGYESKFYNILKE
RDYGTVGKFLEKLSNEEICKKPTEVGTEKASKVDFTNDKAEETFSHTEYCQPCPHCGVKR
EDNEWKKKSDNEKCPIKLYRPKNGEHGTPINFLYSGDRHEEIENKLNEFCNQRSGSSGGG
SDDCGGTNNSDCSLCEPWQCYQFDQLEKDKVGEVDEDDLQYENDVQNAGGLCILPNPKKK
EKESDANSEKEPDKIQKTFNNFFNFWVAHMLKDSIHWRTKRLKSCISNGAKIRCRNNEKC
KTDCGCFERWVKQKKDEWDKIKEQFRKQKGIDDVKGLMTLTHDGVLEGVLKDEFYKDNSE
NNFEEKSENSLDAEEAKELKHIREIIESEDKNQEASVGASDGKKKTIMDKLIDYEEDEAE
LCLEIHDEEEEEKEKGDGNECIEEGENFRYNPCATPSGNYRALATKVAQLMHDQAKTQLA
SRGRRRNLRADATKGKYRNHGNPEDFKKDKICSIDAKHSNRNPEHSEEPCDGKGTGDGIQ
TRFVVGTEWETDPEHMRKDHEDVLIPPRRRHMCTSNLEFLETKDTALEGKGENGKFVNHS
FLGDVLLAANHEAKNIIDKYKEKNNLNDKKDLSDPNDQATVCRAIRYSFADIGDIIRGKD
LWDHNDQKTKLQVHLKNVFAKIKEYHPAIQGNKKYNDDDNNNPPYKKLRADWWEANRHQV
WRAMKCATKDINNNKCNGIPIEDYIPQRLRWMTEWAEWFCKMQSQKYDELVKGCKECKEK
GDKECTKGSGEICTKCDKQCKEYGKNIKTWQNQWTKIKEKYEELYEQAKITSTNDGPTGF
DDPSPDYQQMVDFLTQLIRQSGGGKDGAGSSATKSPYESAAGYIHQEAHITECQEQTQFC
EKKHGETPPNGENNTDKEYTFKQPPPKYANACECDGKSPQAPKKEEKKDACTIVDGILKG
DYGNGKVGECNQKYDGKIPYPGWDCENNIDTDHTGACMPPRRQKLCLHYLKKLTVPAEKK
EEVLKTAFIRTAAAETFLSWQYYKSKHGNGEDLDEQLNNGEIPAEFLRSMFYTYGDYRDI
CLNTDISKKEGDVKDATDNIGKFFSKDGKLDDLSRQDWWNKHKDEIWKGMLCALSYDTEE
KNVNTQIRQRLTEYYDYKNVAFTYKSGTPLEKFAQTPQFLRWFIEWGEDFCKKVSKELKT
LQKACPQNVCKDADASKKKVCSDACANYKTFIKQWREEYKKQSKKYTEDKTAKKYDNHSV
ARDAKDAREYLDKQLQKSCNSGGKCDCMNKKSMSNRNNMPASLDEVPQGYEGRCDCTKAL
LPPEVPGVQKTQVENACTTVEQLFENENAKNFKEACALKYGRGKYSAWKCDNKTSKTDKD
DGVVCIPPRRQKLYLKYLQELTDGTSPEALRKAFIECAAIETFFLWDRYKKEWMAQKLAE
QEREGALPGVGGGNVDDEDKDPQTQLQSGTIPLPFLRQMFYTLGDYRDICIGGDRDIVGD
TIVSNTEGSGSSETKKISKIIEETLSKQSGTPPPTPGTQTQPSDKRKTWWKKYGPDIWKG
MVCALTYDTNSGGEGTTIEKVKTQENNLFEKLKDTYDYEKVKLEDTSGAKPTTTAPSSSG
DDPINNPKLSDFVLRPPYFRYLEEWGETFCRERKKRLKKIKEECRGVNNSGDPKYCSGDG
YHCTGDAKYRNDNFVELDCSRCAEQCTYYKNWIKNKKNEIKKQKRKYEGELQKLKEVNSN
DGDNTKFFKEIENRSFDQFLKALKHCKNDKGSEDDIYKEDKDNKIDFENIPQTFSRSTYC
KACPIYGVTCNSSSGRRRSDHNPCRNNEPQKAANTVGEETPITILIDDGSNHSATNGATD
GSTDGTTKDSYEELKNCSKKYSLFKGLIKQEWKCQKKKGVDQCKLKNFSDDIDDDEHIVF
NEFFQRWLRNFVHDYNKLKHKIHPCIKNEDGKEHKCIEGCKKKCECVEKWLNKKSTEWDE
IKRHYKKNPNFANESIPYLVKSYFELLYFDSDYKRAQEVVEEKNKRDDLWGCTDRDGCDS
EEEREKYGDFITNLIDRLKEKIESCQIQHEERPDKKCEQPPPSPTPDDYTHTDDDDAHEK
EKQSPKFCKDGVVPDKETKKDEICKYGKIRFNCETIKIPDISTTYKDKTNLIGLNAHNVK
ASSNSNVYISPRVQQLCLEPLQLLTKSNTDTTDESKLIEAFTKCAYNEGKGLYKYYAKNK
SELGKNGSTLSDKEVETFTLEAMKRSYADYGSIVKDDMLWNYDNSYDINEIIFDIANKNN
QIQNKSLIDYETKERQNLWELIKTHVWKAMLCGYKDAGGNMNSLPNGGEFCTLPSTDEED
QFSRWFVEWGENFCIRHEKELKQLKDKCKNGICKITDEGEKQACQTSCKDYKAFLKNYEN
QFKKQSIVYDELKKSNSELRDKSALWFLKEKCNSKCLCFKDMNENEYNKIFQYPSDEVKN
LCTCTSKDTSKTTPTNCIEKAAYELQQDVAKKIGNKSKNLKGNEIALFECRKGDHVVIDN
SDLTKKIDKDKLEHFFPSNRYSCKRKGTINVNVEEWDCNYRNINFREQHICLPPRRQFMC
MKKLEDISAKVVEDKDKFLEVVMEVGKEEGIRILRNYQEQNKTDFSEICHDMKYSFADLG
DIIRGRDLWRSNMEQQRIQQKLKTIFRYINDDLVKQNVKKYQNDGGNYYTLRSDWWDANR
KSIWKAMTCCTPRSAYIYTNTTTITTLDKDENQNQNKTRLTDMNYYCGYGKEPPYVDYIP
QKLRWMTEWSEYFCKALNKKLETFKTVCDKCIQSEKKCHDNNKGKECEKCKEKCSKYKDF
VNTWKGQYDLQAKAYEELYKKIDVDTRNYVSDNDKYVIQFLKQAKETCGNDDPSSADKYL
YKTSNCKEYKFNDQFEHSNKIYAFNEQPKGYESKCTCEITQHPLDDCPDDTNKEVCTKFE
VIKRCKKKNFNNDLDNWDSYYVEDFTGKNKGVLVPPRRRHLCLNNTIIKLRSMRHKEDFK
KEFLNSVYTESKFLWDKYNKNSKDVMKAMKYSFADYADIIKGTDILDTTTTKNINNRLAQ
LLKESSYSPKNVDSWWKKNKKHVWNAMLCGYKEAGGKIEKEDCELPTDYSPDQFLRWFQE
WIETFCTERQILYNMVKTRCNNVTCDNVTGKIDSKCIEACKNYSNFILLKRNVYQSLKKQ
YNDNYKSTKADNKEPHEYFKEKCKDDKCACFNEKLNVEDNWKTPYETLDDSELKNKCDCQ
KSERTPHLPLPAREPFDSTILQTTIPFGIALALGSIAFLFLK
Download sequence
Identical sequences A0A191VZ68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]