SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZA3
Domain Number 1 Region: 597-959,1009-1027
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-76
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1045-1377,1408-1426
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-69
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 1865-2252
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.01e-67
Family Duffy binding domain 0.000094
Further Details:      
 
Domain Number 4 Region: 2342-2698
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-64
Family Duffy binding domain 0.00011
Further Details:      
 
Domain Number 5 Region: 1401-1783
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-52
Family Duffy binding domain 0.0000922
Further Details:      
 
Domain Number 6 Region: 2730-2997
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-50
Family Duffy binding domain 0.00039
Further Details:      
 
Domain Number 7 Region: 1-282
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.14e-43
Family Duffy binding domain 0.001
Further Details:      
 
Domain Number 8 Region: 273-482
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-32
Family Duffy binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A191VZA3
Sequence length 3106
Comment (tr|A0A191VZA3|A0A191VZA3_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ21037.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIVRGIDMFKPNVHDKVEKGLREVFKKIHDEMEGEVKNDYNPDGSGNYYKLREAWWDVNR
NKVWEAITCGALPKSAYFLQSEDNKQLFLYPKCGHNNKNDLPTNLDYVPQYLRWFDEWGE
EFCRKRNIKLKKVKDSCCNDKERLYCCHDGYDCTTTIWKKGSLHLDNKCTDCLTKCKVFE
VWLGNQQEAFKKQKEKYEKEIESYVSNDAKFVSNINSEYYKQFHDQLRDKNHNNLDTFLN
LLNEGKYCKEKLKGESDITFTNSSDDKGIFYRSQYCQVCPDCGVKCDGTKYTHKSDNDRE
CVNNEDYKPPRGVKPTNITVLYSGNEQGDITQKLEDFCKSSTNYKDKNNQKWECYYKDEN
INRCKLEQNTEINKDNPKITSFHNFFELWVTYLLRDTIKWNDKLKTCINNTATHCIDECK
RNCLCFDRWVKQKEEEWNSIKKLFTKKNNVPQPYYTNINNLFEGYFFKVMDKLDKNEAKW
KELMENIKKKKSEFSNLENNRDYLENAIELLLDHLKETATICKDNNTNEACETSHNATTN
PCVKPREGTQPTKNIKEIAQYFKRSAYEEARNRGLHKLKGKAHEGLYKRGGKGKDFKDNL
CRIMIKHSNRNLAFSNGPCDGKGTGDGIQTRFVVGTEWEVDPEHMRKDHEDVIIPPRRRH
ICTSNLEHLQTDDHPLNDNIVADLVNNSFLGDVLLSAKYEANKIIRMYKEKNNLKGPKEV
TDPKHQTTICRAIRYSFADIGDIIRGRDLWERNGDMVKLQGHLENVFGNIYKSLKGKGND
KYNDDAPKYLKLREDWWEANRAKVWEAMKCDIKYLKDKSGPQLTQSSYCGYSDHTPLDDY
IPQKLRWMTEWAEWYCKVQKKEYDKLKEKCKECKDNGQGCTKESGRTCTKCTDACNEYND
IIGLWKEQWNIISDKYKELYEQTQMSVSNSGIEASNVVKNHIDRNVIEFLSELYQQNGGK
SNKSGTSDQSAVIGTNTTYENVGAYLHDTGNFDDCQLQNEFCDEKSDGKDKEKYAFRDKP
QDHDGACGCKGRPKQTVVQIKTKEKAQEKDTECKTVNDILKENDGQKQVEDCHPKKNSNG
YPDWKCGNINLVEDPRVCMPPRRQKLCVHFLANDNEIKKLQSQVNLKEAFIKSAAAETFF
SWYYYKSKDGEGNELDKGLEEGKIPPAFLRSMFYTFGDYRDFLFGTDISKGHGEGSKLKK
QIDSLFKNGDRKPPNGKTRQEWWTYHSHEIWEAMLCALVKIGAKKDDFTEKYGYNNVKFS
DESTTLEEFAKRPQFLRWLTEWYDDYYYTRQKYLKDVQEKCKSNDELKCDTECNNKCEDY
EKYMKKKKEEWIPQDKYYKYERDKKRFDRQHIGVMVTDYTGTNATDYLKRKFTASCGDKP
GGSSVVQRNIQLLEKQAYYDADKHCGCTKFIENDDKYTNISSKDNCKGLVKEANTGAIKW
QNKGPNNYNNLKKLTEEVFFPSRRLRICFHALDGNYTDPEVKDENGLRKRLMEVAATEGY
NLSQYYKEKKEKEKETKAEADKYSYDVQPCSAMKYSFYDLRDIILGYDNLEEDKQDIEKN
MNKIFSKNRISVVKESDSSTGNPGRSVRREFWNKNEECVWNAMKCGYKKSGETIPDECKN
MPRDSDYPIASNRDEGTAYQFLRWFTEWGEDFCKKVSKELKTLQKACPQKTCKDAVASKK
KICSDACTNYKTFIKQRREEYKKQSKKYTEDKTAKKYDNHSVAKDAKDAREYLDKQLQKF
CENKSGDCEYNCMKDASTQLLTDGHSQNMPASLDDEPKEVEGKCNCQVAPGPPRVRRETP
SPRVSLIPKAVASKKKAKTATPTKQPKKVEKPPREIRERIRTRRAAPEIRTGTARTAPQA
LTQTSTPTTTETDVATMVKAIFSKERDNKGGIEGCNPKDYPKEKPYPGWNCTDKVIKGEE
GACMPPRRKKICINNIQYLNNKTEDKPEKDIKEAFIKCAAIEIYFWWLKYKNQNPTAENE
LKNGRIPDEFKRIMYYTYSDYKDMFFGTDITNENKIITIKKNVTTILKNENNKKEKDKKK
KDEELLTNFWEENKKLIWEGMIYGLTHDLTNETEKNKITDNSAYKDITKLTPSLEEFAKR
PQFLRWFTEWAEEFCNKRKKELDILQKACDGYEGNERNNGKKQECERTCIKYQKWLGIWK
TQYIQQREKFRMDKKKKNYKDYPSTERDIDKTNCAHEYLNQELKNLCGNKDCSCMEKPSS
QLEKTTQQSRSSDANDMPESLDYPPEKFKKKCKCPDISIKECKIHTKKIPKPKIPMNCVE
KTAYYLSKEAENNMDITVKEEITPIDCTKESRSSGTNNNPCDPKKPYSPDKYISTNPCQG
KGNDRFKVDYEWKCYKNSKFYQEKKRVCVPPRREHMCLSKLDEINIKRLKENDYLLKMFR
RTARNEGIDIIKNIKVKNECNLNPICDAMKYSFADIGDIIRGRDMLRIDGEVPNLEKKLY
NIFERIYEKWKKNNKNDNDLYADVISFRSAWWDANRKEIWKAITCKAPNEAQLFRTGRMD
GFGRITLIQDKCGHNDDPPNDDYIPQRFRWMTEWSEYYCKALMEELEKFKKPCDHCKTSG
RCKNDYDKNKCEECKTRCQEYKNFVLKWKSLFDIQSNKYKELYEQPIDTKISTYDHVQNF
VQKLKNFKSECSVESFSEYLHETSKCLNYKFDENDGSSNIRSYAFEETPKSYKEACSCTL
PSKNPLDNCPTDKNNDGCKELQTFTFCSKNDYDNNLDNWNAYLVLNSSDDNKGVLIPPRR
RHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLGQKYKSEKELCFEAMKYSYADYSD
IIKGTDMMDTSLSEKIKKIFETSNQDTEDCKTWWEKNRSHVWHAMLCGYISKNKNENINP
KWCNVPTEDGTDQFLRWLIEWAMQACKEKKRVRDSLKTKCRCSKEDNFEASELLRQPGCQ
NDIRKYISLNILIKNSMENLNIKYKQLKDQTSGNIDNKPSEENVQSYIKSKYSECDLELN
DINEIDTGTKNNELIEVLKKLYPGSCFVEDKAHKNHVVHENKNEEAKVFFPNELYYFPRY
INFLNLGHLLPTRPVGQYDPKNDILKSSISVVIVSALGLIALLFMK
Download sequence
Identical sequences A0A191VZA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]