SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZB7
Domain Number 1 Region: 1845-2191
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-76
Family Duffy binding domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 1026-1379
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-74
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 3 Region: 621-935,994-1013
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.22e-66
Family Duffy binding domain 0.00023
Further Details:      
 
Domain Number 4 Region: 2300-2612,2642-2661
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-65
Family Duffy binding domain 0.000099
Further Details:      
 
Domain Number 5 Region: 1403-1733
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-56
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 6 Region: 2662-2970
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.93e-53
Family Duffy binding domain 0.00027
Further Details:      
 
Domain Number 7 Region: 1-274
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.2e-45
Family Duffy binding domain 0.00078
Further Details:      
 
Domain Number 8 Region: 307-515
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-32
Family Duffy binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A191VZB7
Sequence length 3082
Comment (tr|A0A191VZB7|A0A191VZB7_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ21052.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIVRGKDLFLGAPNKEKIKLEENLKKIFDNIKNENAELSKLSLEKVREYWWAIHRKELWE
ALTCNAPKGANYFVYKLDGPKFSSDRCGHNYNGDPLTNLDYVPQYLRWFDEWGEEFCRKR
KIKLENVEKACRKDSEKLYCRHNGYDCTKTIKNENILFDDPKCTDCLIKCSLYEIWLDNQ
QKEFEKQKEKYEKEIQTYISNNEISNNNISNEYNKQISEKYTDKKYETLDKFLNLLKEGK
YCKERMTGESSIDFNNDVDKTFSYSKHCKVCPHCEVDCENGNCEVKNKPDGNCGKNVKYK
PPYGVKPTEITVLYSGNEKGDISKKLSEFCSNKNNINVKNNETWKCYYKYSDNNKCKMES
NSENNKGAEKITSFHEFFELWVKNLLKDTMKWENEIKDCINNTNITDCNDECNKNCVCFD
KWVKQKEEEWKNVKKVFENKKYIQDKYYLDINKLFESFLFKVISELDQGEAKWNQLKEEL
KKKIESSKANEGIKDSESAIELLLDHLKESATTCKDNNANEACSSSQKSSPNPCADKSGG
KLVSVKQIAQYIKRQAYEQANYRSDGLHKLKGKAHEGKYKRKGRENYFKDKLCKIGKYHS
NRDPFESKGPCYGKDGNKLSFQIGTDWKGAEEEKMIYNDVYLPPRREHMCTSNLEHLVTD
NKPLDGTDGNPKLVNNSFLGDVLLSAKYEAQRTKEDYEPVSDEQSICRAVRYSFADLADI
IRGRDMWDKDDGAQKMERILKSIFKNIYETIGDKKGKYTNTDGKYLELREDWWEANRAKV
WEAMKCAIKGLNVTSSDGKLSDHCGYSDHTPLDDYIPQKLRWMAEWAEWYCKVQSHEYDK
LNKRCVVCMQKDNGKNCWKHNSECGVCKGACTAYQGKLLPWEYQWNVISHKYETLYEKAR
IAAHNGGLDTSSGDVDPKDKTLVEFLFNLYVQNGGKIGTIGTTGDKDTRDTTPTVYSTAA
GYIHEEAHIGDCKEQKQFCEKKNGAKPPSGDLEGDKEYAFRDKPTDHDKACDCESREKLQ
NKKTEGTVLEEPCNVVKTLLKGKNENSDIDQCIRKYKDGNEKYPGWDCTRNKIKIGEDGA
YMPPRRQKLCVDFLKQLKGQTDEKLRDAFIKSAAAETFLSWHKYKEDTQKEKATHKADND
LNEGIIPEDFIRQMYYTFGDYRDLCMNKNIGNDVSNVENKIKDFFSKADGTSSSNLSREV
WWKKHGPKIWEGMLCALPGTANFQNKEDYKDPPEDFAKQPQFLRWLTEWYDDYCHTRQKY
LTRVESTCKLNDQSQCAAECNNKCDEYKKYMEGKKKEWDAQYKYYKEQRNKKEVVNDSKG
IIVKDYVLANAKEYLKKKFTASCVTSSGKAQNSATEEVKKNIELLSEEQYYDAKEHCGCT
KFIHDDKYSKISGRSNCCGLNSDAKKNKIKWRNSDEKDYAFLKERNLSGDVFFPSRRLGI
CFRGLDGYYRYPEVKDKDTLRKTLMEVAATEGYNLGQYYKEKKKANKEAYRYSYEVRPYS
AMKYSFYDLRDIILGYDNLEDNSTTTEKNMKEIFKSESNEGSQGRQTFWNNNKDCVWEAM
KCGYNKSGETIPDECKNMPRDSDYPIGSNRDEGTEYQFLRWFAEWGEDFCKHKEKELKKL
VGACNDYNCGDNEDKKKKCTSACTQYKQFISEWKPQYENQIKKYGKHKHKIYSEHPVAKE
AKDAQEYLDKQLQKSCNSGGKCDCMNKKSMSNRNNMPASLDDTPSEYKKKCNCPLPPKKP
EAPLARAAAPPASTTKNPPSRKTQPSQAAREMQADESASPSPRVSLISKATASKKEAKTA
PPTKQPKKVEKPTTEMRARKRTRRAAQQTQTRTARAAPQELTRTSTPTTTPSDVFTIVKS
VLSKTPDSKGGIEKCYPKTNGKYPQWDCNPRKFKENENGPCMPPRRKKLCINNLQYLNNK
TETKNENDIKEAFIKCTAIETHFLWKKYKGNNHELDEKLKDGDIPKDFIRIMFYTFGDYR
DIFFGTDICKDRNIDTISQNVEKLLTKEKDDISKTMDEIKRHYWEQYGPDIWKGMLYGLT
YHLKDEGKNRIPEASKYQYNKLKPDLEEFAKRPQFLRWFTEWAEEFCNKRKKELEILKEK
CPDYTCSVDSTKHECEDSCKKYQTFIKQWKTQYEKQREKFKNDKDPDKYKDYPSIESYID
NATDAHEYLHRQLKELCGNNDCSCMEKPSSQLPKTKSTSEPPNSNDMPASLDEVPEGYEN
KCDCKLQKMEKPDPSLNCIDKSAFQLYAKAKNDLHGMKDELKGKNPKAVYEEKTNGTNGI
NIICKINEKISKQKNVCINNENPFDDIDKWDCKERSRTLAIENICIPPRRKYMCTNPLEN
LEGKKSISEALFRKVLRTAAYEGKHIKDSWDKKTKPKKRNQICDAIRYSFADLGDIIRGT
DTYKGPNGANGVETKLKAVFQLIYTNFISSSDMVVRKYPNIQSFRSAWWDANREYVWKAM
TCDAPEDAMLFRKLENEEIPNLILSQHKCGYNDHPPVDDYIPQRLRWMKEWGEYVCKILN
EKINNMKNDCDQCKLNGKKCSDDDDGNKCTNCKEKCKEYTKLIHNLKSQFNIQKQKYNEL
YTKIQNNRRGFTNDNDKNAIEFFEKVKMINKCDVGTPDKYIDKAIHCIHYSFTENENENE
NKNKPYAFNNHPEKYKSHCSCTITHHPLDKCPFNDKTNEYCKTIRHINPCIRRYFDNNLE
TWTGFVVDNISHKNKGVLVPPRRRHLCTTKLTGNRYRTNEKDNLKQNLIDSAFSHGILLG
KTFNDYTNQGLESMKYSFADYADIIKGTDMIGGSNIDDFNNDLKQMFPENSSENIKETTI
SRKHWWEENKTHVWNAMLLGYQKGKKNNGEMDKNWCNVPTEDGTDQFLRWLMEWAMQACK
EKKHVRDSLKTKCRCSNEDNFEASELLRQPGCQNDIRKYISLNILIKNSMENLNIKYKQL
KDQSSDNIDNKPSEENVQSYIKSKYSECDLELNDINEIDTGTKNNENNEFKEVLKKLYPG
LYFVEDETHKNHVLDGNIKEEEQTVRPEVLYFFTPHVDYLYQGLFLPTYRGEKYDPKNDI
LKSSISVVIVSALGLIALLFMK
Download sequence
Identical sequences A0A191VZB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]