SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZE3
Domain Number 1 Region: 641-974,1016-1035
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.19e-82
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1040-1386
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-74
Family Duffy binding domain 0.0000594
Further Details:      
 
Domain Number 3 Region: 1404-1493,1579-1601,1635-1658,1693-1743,1793-1836,1866-1962
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.93e-71
Family Duffy binding domain 0.0008
Further Details:      
 
Domain Number 4 Region: 1-296
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-53
Family Duffy binding domain 0.00075
Further Details:      
 
Domain Number 5 Region: 1948-2172
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-37
Family Duffy binding domain 0.0055
Further Details:      
 
Domain Number 6 Region: 287-529
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.63e-36
Family Duffy binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A191VZE3
Sequence length 2196
Comment (tr|A0A191VZE3|A0A191VZE3_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ21076.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIIRGKDLFIGNNKRDKLEKQLQKYFNNIYENLKGAAKKHYNGDKENFYQLREDWWNANR
HTVWKAITCNAWGNTYFRTTCSDRNGSFSQANKYCRCNDDKPGNDKENIDPPTYFDYVPQ
YLRWFEEWAEDFCRKRKYKLENAKKFCRGDEGMGEDKYCDFNGYDCKGTASGKHKYLWDY
KCAGCFFSCSDFRKWIAKQKDEFEKQKNKYDKEIGKAKNTTQVPNGNISNIYEKEFYTHL
EEKYKTVDAFLNLLNKETACEKQPYDEGRTIGINFKNDQPEDIFSPTEYCEPCPWCGIEK
QQGGKWKRINNHSACEKEELYTPKENATSTKINVLTSGEGEKDIAEKLEAFCKTQNGTGS
GNASSGVGGGNSDSSLYDRWQCYQFDQLTKHGQDVVEEDVQKVKNAGGLCILEKTNGKEN
VNKQKTFNNFFNFWVAHVLKDSIDWRTQLTKCLSEDKLKKCEKGCKSNCECFKKWIEKKE
KEWIEVKQQFNKQTDLPGGLSHYILLENILEHYYFKNIQKAYGDLKSIQEMQRIIDANKK
KTTNRSKDDVDALDVLFDHELEEAEDCLDIHEDDDDADECVEESEKIPNNPCSGTRHRAM
VKNVAADMYRAARQQLRNRGGRKALKADASKGHYNGKANESVLNDVCDITNQYSNAIGAS
NNPCNGKGNGKDQRFKIETQWKDTGENGTQIGVYLPPRREHMCTSNLEYLLKARGGQFGQ
VESGKCNHSFLGDVLLAAKMEAEDIKSRLNNNGNSSSICRAMKYSFADIGDIIKGTDLWV
HPYQTQLQGDLKTIFGKIKDELKGIETSKYTNTDGKHKQLRADWWTANRRQVWKAMKCAT
KNSKIPCHGMPVDDYIPQRLRWMTEWAEWFCKEQYSLYDKLETDCGSCKIKGKVQGCTSS
DPKCKQCKNACEKYKEEINKWKQQWDAISYKYLMLYYGAKTTAAYGTVAYSGDVEPKDKP
VVAFLQELQKQNSGKTTYDTADRYIHQEIGNVGCNIQNEFCDKKNGETSTSSDKKVDNDK
YAFEKLPSEYQEACNCNENVTPRPPALSNVCNTVKTLLNAHAGQDKIDSCNKKNDRTWNC
SDDTFNEHNKGACMPPRRQSLCIHSLEHFSGTSQNKLKEAFIKCAAIETHFLWIYYKNKN
SSIVETQLRNGNIPQEFKRIMYYTFGDYRDICLGTDISSDSNIKGISQKVNDILNSQNGK
THEQNITPKTWWEKNKNDIWQGILCALPYSEKFKNKNEYRNPPDDFAKKPQFLRWMIEWG
EEFCAERQKKEDDVNSKCKGPNPSSACDKGSSCKSACTEYENYVKSKKVEFNGQTDRFVR
NANETSPDPEYSGYEHKQGEETKQGNDYLLEKCDNAKCSCMDGNVRSEDPSVKPFGRYAH
QYSNKCNCLHGKYSPSAPPPRAQPPQEPPAAPTVVDVCTTVAEALKDDKSLQAACQQKYG
KTPPTSWKCIPSGDKAATRGNDATTGGLCIPPRRRRLYIGKIKEWAGITVNGDSSESSVS
GSGTESQEGEKSTEGKGQGTQLQETSKAKPSLSDGQTASDSSAQTASDSSAQTASDSSAQ
TASQPNSHPTSATASRAQDPLLTAFVESAAVETFFLWDRYKKENTKTQSVGSLPLQLPPG
VSDDPDNPQSKLLNGEIPNDFLRQMFYTLGDYRDILYSGGVDNTSDSGNTNGSNNNNIVL
EASGSTEQEKAKMEKIQKKIQEHINSGSTPRSAQNGFQQRENLWSTFAQPIWNGMICALT
YKENSSGGDGKTTTITQDTNLKDQLLENGNPITKYQYEKVELEDESGAKSNDDTKLKNFV
KRPTFFRYLEEWGENFCKKRTEMLGKIRGECTDGGGNYTGRYCGGDGFDCIKIGPNKDGI
IKGFDCPSCGRECRKYKKWIEKKKTEYEKQKNAYEQEKKDAEGNNNGNEFSTKLQSLHDA
EAFLNRLKNGPCKTNKENGEDDIDFDKDSKTFQHAKNCDPCPVFGVNCDRGDCSKATVEV
CDKKKVITTEDVKKNNDYINVDILVSDNNENDFPDKLDVCKGTGIFDGIREDKWICGYFC
KSDVCVLEKSDEKKDVEQNIQIRALLKRWVENFLEDYNKINDKISHCIDNGKGNICKNKC
NDKCKCVGEWINKKRTEWKTIRDRYVKQYNGGGTEKKTLVKNFLEDLQSQIDFKKATGRK
NISDFESKVCNCPENSKQKDEKKDIIDCLLDKLKKK
Download sequence
Identical sequences A0A191VZE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]