SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZE9
Domain Number 1 Region: 606-940,989-1008
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-77
Family Duffy binding domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1-290
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-54
Family Duffy binding domain 0.00044
Further Details:      
 
Domain Number 3 Region: 324-477,510-530
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-33
Family Duffy binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1021-1113,1164-1186,1231-1259
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-31
Family Duffy binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A191VZE9
Sequence length 1277
Comment (tr|A0A191VZE9|A0A191VZE9_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ21090.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIIRGKDLYLGNKKEKEKLENNLKTIFQKIYDKLENKKAQEYYKKDDKGTKNYYKLREDW
WNANRYDVWKAITCKAEQNNKYFRKACSNDTTWAENNCQCIGGTVPTNFDYVPQFLRWFE
EWAEEFCRIKQLKLKKLEKECRGQNDSGEPRYCSGNGLDCTKTVRAKGDIIMGNKCTKCL
VACNPYKEWINNKKKEFDKQKNKCENEIYSVGNSKKQSTSSTNKLYYDKFYDELKKHYRD
LEEFLKLLNKENTCKSITKTESKIDFSKTSDKDLDHTFYPSEYCKPCPYCGGSFNGEKFE
SKGEQERDCPGLYNIYEPPNDVQPTEINVLQKEKEGRDILEKLKTFCSTDKDKPVIKNDE
WKCYHQNEGNDKCILQYDEKDKNKKNVKDFYGFFEFWVTHVLNDSIEWRNKLKKCLENNN
KQCLNNKCYTNCKCYESWAKKKQEEWGEIKKHFDKQTGFYGWSRYQVLESVLEDEFLKGI
TEAYGDPQQVQRITGHLETKNSQERIDATQKKTIIDILLHHELEEAEECLETHEKDETCD
YDSEEEEEEEEFRDNPCSGGTHRVMIKSVAADIHQNAKTQLRNRGGRKVLRGEIKNVKFY
NGRNSIQLTNVCDITFTHTNESNGIPKDGPCQGKGNGFTIGTSWISGDSISKDHKDFYLP
PRREHMCTSNLENLKDNDKSVRDTDTLLGEVALSAKMDAEEIITRYKNQNNIEGPIEQKH
QESICRAVRYGFADLGDIIRGRDMWNKDSGSKDIEDRLKKIFKNIYEKLGDKIDKYTNDG
KHTQLRADWWEANRDQIWKAMKCKTNGVDITCDSDHTPLDDYIPQRLRWMTEWAEWFCKM
QSQEYKKLEGKCKECMKKGEGGKDCTNNMTECQVCIPACTGYKNFIKKWEKQWETVSAIY
QILYEQARLEINNGKPSAYGDPDYQQVVHFFKELQKSIKSSASKRSKRSLPRDTSTPYST
AAGYIHQEIGYGGCQEQTQFCEYENGVAEKNEKYAFSLEPHEYKGACNCKNNEPPPPPPP
PLVPVVPAINVCSIVAKIFEDTTALQAACSLKYGPGGKERYSQWKCIPTSGNNTTTAGSS
GKPTGSSGSICIPPRRRKLYVGKLQEWAEKQSQSQNGESSGEAQPQASEAQTQPPVAVSQ
ISNGEPTLSAASTSTTESSHLRDVGLLKAFVESAAIETFFLWDRYKKIKEKELEEKKARD
QELNGTLLLPRAQKVSPEVDPEHPQNQLKKGIIPEEFKRQMFYTLGDYRDICIGDEKVIE
MLKDGGIDISTINEKIK
Download sequence
Identical sequences A0A191VZE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]