SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A193PCY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A193PCY6
Domain Number 1 Region: 142-286
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.05e-17
Family Duffy binding domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A193PCY6
Sequence length 529
Comment (tr|A0A193PCY6|A0A193PCY6_PLAFA) Duffy binding-like merozoite surface protein 1 {ECO:0000313|EMBL:BAV14344.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=mspdbl1 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKKIYSIFFSLFILNLHIYIKNIKCNDLINYNDSNLRNGLLNNSLDLTNGLNNKDNSFID
SKIEEHENKSYQNKDNNISIVGQDVPITSVDSSKIINANDLEGNSIDDTKGLSVTNSGFD
DGSAFGGGLPFSGYSPLQGNHNKCPDENFCKGIKNALSCPPKNSTGRNGDWIPQYLRWFR
EWGTYVCSEYKNKFENVIELCNVRQITNQNDSQLLEISEKDKCKGALKHYEEWVNRRRPE
WKGQCDKFEKEKSKYEDTKSRTAEIYLKEICSECDCKYKDLDNTFKEFNDNVTLLKAVID
NKKNQDSLTTTSLSTSINSVRDSSNLDQRGNITTSQGNSHRATVVQQADQTNRLDNVNSV
TQRGNNNYNNNLERGLGSGALPGTNIITEEKYSLELIKLTSKDEEDIIKHNEDVREEIEE
QQEDIEEDEEELENEGEETKEEDDEEKNEIEEENKEKELSNQQQSEKKSISKVDEDSYRI
LSVSYKDNNEVKNVAESIVKKLFSLFNDNNNLETIFKGLTEDMTDLFQK
Download sequence
Identical sequences A0A193PCY6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]