SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A193SJF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A193SJF1
Domain Number 1 Region: 288-472,746-850
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-18
Family ABC transporter ATPase domain-like 0.032
Further Details:      
 
Domain Number 2 Region: 21-129,159-192,219-266
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000000000471
Family PHP domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A193SJF1
Sequence length 888
Comment (tr|A0A193SJF1|A0A193SJF1_9PSED) Histidinol phosphatase {ECO:0000313|EMBL:CZT26357.1} KW=Complete proteome OX=1583341 OS=Pseudomonas cerasi. GN=PCPL58_p5004 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKSLPPKQSRARSVVFAEGAQWIRADFHLHTRADREFKYTGDDNFYHSNYVDALEKASIR
LGVITNHNKFDLDEFKALRKTAQNKGIALLPGVELSVNDGANGIHTLVVFSDEWIDEHDH
INPFLTSAFEGKTPAQYEQENGRSSWSLLETIKKLESYHRDFFLVFAHVEAPSGLWAELD
GGRLTDLGQNEFFRRRTLAFQKVRTHDGAGKDKPCRTKIQSWLQSWYPAELEGSDPKGID
EIGRGKTSYLKLGELSFGAVKFALGDPAARVAMEPQKHKASHIRSIHFDGGILDGQTLHF
SSELNALIGIRGSGKSSLLEAVRYALDIPRGEKVQDTKYKDELIRHTLGSGGKVTLTACD
IYGQEFTISRIFREAPNVYLGGTLQPGVSIRETVLRSPIYFGQKDLSSTGEGFETDLVEK
LVGEKLRVLREAIETQRQRVCEAAQRWLKLSNIAETKRDFNAQLTDANFRLKKFEEYGVA
DKLQKRLGFQQDATALARMAERADDFILALGSLIAEHEDELRNATSYVSKQNPDFFVAYN
AEFSNLVAGVDQLKQIEQDMRAVAARLGTKQYEFEGASKSLQEEFAQVERQLAQELKQTG
MTAIQPDDFLAQQQRKTKAEQMLDALAKQESQQTTIRDALFAEIDKLNELWLREFTTIKT
ELDRVNAVNTALQIEADFKGDKEAAISFMQQLFKGSNIRETTLRAVMEDYADFGGLLRSL
PGALVKAGSAPEVFEKTFMQYLVEFSAWQVPNRFVIRYRGKELRHHSLGQRASALLLYVL
SQRQNDVIIIDQPEDDLDNQTIYDDVIKLLREMKPHAQFIFATHNANFPVLGDAEQVHAF
QYQDEKVATQSGSIDAHPVQEAIINIMEGGQEAFNRRKEVYNLWKLQS
Download sequence
Identical sequences A0A0P9JGP3 A0A193SJF1 A0A2G0XZP7 F3E4J5 H1ZWY7
gi|410686311|ref|YP_006961584.1|NC_019266 WP_005740914.1.3022 WP_005740914.1.55113 WP_005740914.1.64028 WP_005740914.1.69804 WP_005740914.1.77880 WP_005740914.1.87724 WP_005740914.1.91552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]