SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194Q760 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194Q760
Domain Number 1 Region: 1532-1805
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.98e-54
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 963-1217
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.64e-46
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 3 Region: 345-601
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.04e-46
Family Eukaryotic proteases 0.00074
Further Details:      
 
Domain Number 4 Region: 1219-1253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 225-283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000695
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 1252-1293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000113
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 1404-1467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000334
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 8 Region: 1335-1373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 9 Region: 778-817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 843-900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000764
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 11 Region: 745-776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000929
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 12 Region: 47-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 1303-1333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 14 Region: 695-736
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 15 Region: 659-694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 131-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000011
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 17 Region: 165-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 18 Region: 82-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A194Q760
Sequence length 1817
Comment (tr|A0A194Q760|A0A194Q760_PAPXU) Limulus clotting factor C {ECO:0000313|EMBL:KPI99230.1} KW=Complete proteome; Reference proteome OX=66420 OS=Papilio xuthus (Asian swallowtail butterfly). GN=RR46_05414 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MWDKTYYVFLVTLVSVLQASVVYDVYDRGTHWHNISHSRQKRDEPDCSMNEWRCNEGTCV
RINSDCDGIIDCPDGSDETFELCRNHECDAFTFRCNYGACVDESAPCNHKQECPDDSDEQ
LPRCKGQTIIEGDKFRCLDGQLLPLDRRCNGIVDCNDRSDETLSSCAELTCNEDQFQCEY
GGCVDAEAQCNRTIECVDESDEKVELCGVRTLIRPTTPEPVTEPPKCTIPEAPTNGSYNV
IRETNTTEVDYLSLEYSCDQGFKLVGEVKVVCLNGIWQEKPRCIQTCELIKHLSVDYECF
EESGKPRACYTEEIEGTVVKTSCKAPHYYSPVELPYMHCIQGVWTSGPACAVECGVQPPK
STPLVLRGRDARFAEVPWHVGIYFKNPMSKTHVQICGGSLISNTVVLSAAHCFWNEDIRG
LNRPMWYSLAVGKLYRDWNHPNDELYVQKSGVSDIIVPKLYRGLELYYKNDIALVFATQA
FQYKPHVVPVCLDFTEELGNLQLRNGNRGKAAGWGLTTGLAGSEAPRLKVIELPYENYES
CLNLTSPALSRYLTYDDKICAGSLDGEALCRGDSGGGLAFPWDEDGKARFYLRGVASTSP
PSNDVTVICDTMKKLYDINYGICIFEIKASVLYNNDFIRSYESYSRNVSLIRNKRDLDEC
SYNEYECKDGSCVRANSDCDGVYDCVDGSDESFSICRNRKCRANQFRCNYGACIDRYNDV
CNKRVDCVDGSDELTEKCTGIKLTDGDNFICRNGQLIPKKGRCDGVNDCADGTDENIAAC
VNITCDVGQFVCEYGGCVDGKSLCNGTAECRDGSDERLDICGRLTLIKVTDVSTTQAPVV
TPKCVLPPEPQNGVYRIISETNSSDADYVYLQYDCYPGFRLIGEPKILCWRGVWPRIPYC
IQTCPLRKDPSIEYQCTEEDLETPRQCEEEEVEGAIVRPACKQPHYYSPVELPYMQCSQG
AWSSGPVCVAECGTTPPIVSQLVLGGETARNGEVPWHAGIYVKNPSLNNYQQICGGSLVS
TTVILSAAHCFWNEVTKRLENKHNYAVAVGKLYRDWDHVKDERFVQKSNISKIAVPKLYR
GIELDYHHDIAVVVVTKPFEYKLHVSPVCLDFRPDFNNEQLQSGQLGKAAGWGLTTKYRG
SESQELKVIELPYEDLDRCINLTSRQLKHYVVYDKICAGSLDGEALCRGDSGGGLAFLSE
VSGVSRYYLRGIASTSPLNDQWQCNGGRCINVDSICDGVPDCRDGSDEVHALCRKMRCPS
NLFRCAYGACVSGNAPCNGRVDCADASDELSPICRTNSDEINGQYKCINGQLIPAENRCD
GTPDCNDGSDETVRSCAAMSCLPYLFQCAYGACAEQGAECNGINDCADGSDESIELCGNQ
TIPHTTKSTPRTTTQPTIVTNINSKCKLPDYPQHGTYDVIGSPNAVPGQILNTPTLKFTC
NTGYGLDDPSNIYCSDGIWSAAIPRCLRQCKDIDNPTASYECDMVYGNNTKSSWPCREYE
LEGTRAAATCKPHYYWNGAKIKAHCVDGKWENVMKCLPNCGTVVDKSTELVIGGKVAVRG
ELTWHAGIYKLSPDARQYDQICGGSLIKRSTIVSAAHCFYDDNNEALHPAKNFAAALGKI
YRSWGDTRDNDAQKRYVKNIHIPETYKGRENNHQDDIALVIVDKPFTYTSYIRPVCLDFK
LDFEMGQLQPGNMGKVAGWGMKDTSGQASDVLKVVELPVVDFKVCWDRAPFDFKASITSN
KFCAGYYNGTALCQGDSGGGLSFPSEESSVIRYYLRGIVSTSPASVDQDLCNAMTVTTFT
KVTLQEAFFSEYLREEY
Download sequence
Identical sequences A0A194Q760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]