SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A195E2Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195E2Y6
Domain Number 1 Region: 11-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000136
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A195E2Y6
Sequence length 365
Comment (tr|A0A195E2Y6|A0A195E2Y6_9HYME) Ropporin-1-like protein {ECO:0000313|EMBL:KYN19272.1} KW=Complete proteome; Reference proteome OX=471704 OS=Trachymyrmex cornetzi. GN=ALC57_08449 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
MSFVEQPTFEREIAVPARLPIILKQFCKAAIRTQPYDLLKWSSSYFRALADGEEPPIKSR
LEYPPPSTASGLTLGFLRVLLRQFGNYNKTLPIEIILRRWDCLCLDHRDFDTILAIGRFH
HTCQVKKFLAVAVGLLGANLTETMIMICQLFSHEPDGGSAMIPLTLFMEIYEYLAGLACD
GNEKNTFDQDTTELTMCKESSVDHTTCSVNSQDTDVDINLDSELISKDEVDLSKTDLSTE
PIENSSFEGEATNYEEKGDKSLTNQKDDGSIGKDSTDNNDTISKKFCGVKDVNSDRSLSS
GVEKDAKMTCFPNVPGIGPRLSAKRVANVTAWMLECARLQEGMVGPRNIRHTNCPSLHER
STSKS
Download sequence
Identical sequences A0A195E2Y6
XP_018363856.1.32933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]