SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A195F081 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195F081
Domain Number 1 Region: 110-226
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000589
Family Duffy binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A195F081
Sequence length 280
Comment (tr|A0A195F081|A0A195F081_9HYME) IQ domain-containing protein G {ECO:0000313|EMBL:KYN33980.1} KW=Complete proteome; Reference proteome OX=34720 OS=Trachymyrmex septentrionalis. GN=ALC56_11794 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
LRCSLYVCSIIEDLKREISEHGTIDVLIKEIERITSQKEQEHLLIEENENMQIIVAELRK
TIADKKTANEMEEERLTKKLTLTRDEKEKLKLIKDVEIKYVRVWEAARREQYVLHYELKM
DELKKTLNNHCVRESNENHVNDVLTRYLTQRIALIETWIEQWRQRYDREKKMYEKEIRKV
RNEIGNAQKYLEELTTEIKYVGKFALKLIRYLLQYCSNQEFIDTYLAEQEALRRQKEHED
HVRHSIIKIQAWWRGVMVRRKLGPYRSEEKKKKKPVKTKK
Download sequence
Identical sequences A0A195F081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]