SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7VIY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7VIY8
Domain Number 1 Region: 415-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family Merozoite surface protein 1 (MSP-1) 0.014
Further Details:      
 
Domain Number 2 Region: 369-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000871
Family Merozoite surface protein 1 (MSP-1) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A7VIY8
Sequence length 476
Comment (tr|A0A1A7VIY8|A0A1A7VIY8_PLAKH) Merozoite surface protein 8, putative {ECO:0000313|EMBL:SBO21824.1} KW=Complete proteome OX=5851 OS=Plasmodium knowlesi (strain H). GN=PKNA1_C2_1031500 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MKKNAQIIIFFLFGLLSCTCGAEGNVNPPNNNGNKGNGNDNNVPTFIGGNNNNVNDNGDD
IFNKNGKDVSRNDGNHAENPNDKKNENGSGSNEKNSVENADNGSGKSDANTNQNGEDANK
VDEASLKKILKIVDEMENVQGLLEGDYSILDKYSVKLVDDDDGETNKKKMIGEYDLKMLK
NILLFREKISRNCENKYITILPELLKKCSNVDDPKLSKASEKIKKGLTKNNISIEDFVIS
MLEDLFDKINEKFIKDYSFDLNDYLIDFELINYIIMQDTSDLINDLLNMLKSMNFKLESA
SLDKMVKNAQSGMNLNSKMKEDIIQLLKKSSAKFFKIEIDRKTKMIYPVQVTHKGATMKQ
FALNFLEKNNVCEHKKCPLNSNCYVIDGEEVCRCLPGFSDVKIDNVMNCVRDDTVDCNNN
NGGCDVNATCTLIDKKIVCECKDNFQGDGIYCSYSIFNSINNFIFLILLLLCLYLF
Download sequence
Identical sequences A0A1A7VIY8 A0A1Y3DQG4 B3L6Q1
gi|193809870|emb|CAQ40574.1| gi|221057321|ref|XP_002259798.1| PKH_103110 XP_002259798.1.91479 5850.PKH_103110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]