SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7W2J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7W2J8
Domain Number 1 Region: 109-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.48e-54
Family RecA protein-like (ATPase-domain) 0.000000118
Further Details:      
 
Domain Number 2 Region: 27-88
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000753
Family DNA repair protein Rad51, N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A7W2J8
Sequence length 347
Comment (tr|A0A1A7W2J8|A0A1A7W2J8_PLAKH) Meiotic recombination protein DMC1, putative {ECO:0000313|EMBL:SBO28127.1} KW=Complete proteome OX=5851 OS=Plasmodium knowlesi (strain H). GN=PKNA1_C2_0503600 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MATLPSSKSTSKVAATTQMEEEVTKDHQFQEIEKLQDLGINAADINKLKGSGYCTILSLI
QATKKELCNVKGISEAKVEKILEVASKIENCSSFITANQLAHKRSKVLKITTGSSSLDRT
LGGGIESMSITELFGENRCGKTQICHTLAVSAQLPRSAGGGNGKVCYIDTEGTFRPEKIC
KIAERYGIDGEDVLDNILYARAFTHEHLYQLLAVSAAKMCEEPFALLVVDSIISLFRVDF
SGRGELSERQQKLNKTLSVLSKLGEQFNIAVLITNQVMSDPGATMTFVANPMKPVGGHVI
GHASTTRLSLRKGKGDQRVCKVYDAPNLPEVDCIFQLSEGGVIDATD
Download sequence
Identical sequences A0A1A7W2J8 A0A1Y3DXW8 B3L1D8
gi|193808003|emb|CAQ38707.1| gi|221053592|ref|XP_002258170.1| PKH_051570 5850.PKH_051570 XP_002258170.1.91479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]