SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7WTC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7WTC7
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000126
Further Details:      
 
Domain Number 2 Region: 210-265
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.97e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 278-369
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.53e-20
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A7WTC7
Sequence length 382
Comment (tr|A0A1A7WTC7|A0A1A7WTC7_9TELE) Wiskott-Aldrich syndrome-like a {ECO:0000313|EMBL:SBP09197.1} OX=60296 OS=Aphyosemion striatum. GN=WASLA OC=Aphyosemion.
Sequence
MNSHPPSRRAVNVGSLLLTPQENECLFGYLGRKCATLCSAVVQVYVADRSYNWVKRGCGV
ACLVKDNPQRSYFIRVFDIKEGKTMFEQELYHNFISSSSRPYFISFAGDNCQIGLNFASE
EEAKRFRVAIHDLLNRRQRKTEKRGDLKNGLSLPMATVDIKNPEINNVRHHSSHSHQQPY
HLNNMLSHSRTRRPKARRKKLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKHLFD
MCGISEAQLKDRETSKVIYDFIEKKEVDCVSGDSPNSPCPGGKSALLEQIRGGTQLKKVE
QNHRVPASSTGRAALLDQIRQGIQLKTVSDPESGNPTPAPATGIVGALMEVMQKRSKAIH
SSDEDEDDDEEEDFEDDDEWDD
Download sequence
Identical sequences A0A1A7WTC7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]