SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8C3Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8C3Z6
Domain Number 1 Region: 356-494
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-24
Family UBX domain 0.0057
Further Details:      
 
Domain Number 2 Region: 99-205
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000656
Family Thioltransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8C3Z6
Sequence length 608
Comment (tr|A0A1A8C3Z6|A0A1A8C3Z6_9TELE) UBX domain protein 4 {ECO:0000313|EMBL:SBP73410.1} OX=1051664 OS=Nothobranchius kadleci. GN=UBXN4 OC=Nothobranchius.
Sequence
MGGFPGGGRGKNLLVSWSGRNVALTGRGILLLLPDEDDRERGSSPAQSDLEPRSEESLSL
SRAQGRLSQDREEEDACACVPVINSEADRNNNRVSEMRWFQGSIPDAISYAKQRTFIFVV
VIAGDDEQSAQLMSTWEDQRVSEAAESCCVAIKVDASSDTCVQFSQIYPVVCIPSSFFIG
DSGVPLEVVAGCVSPDELVKRISRVSQMQTRQIGSGGTVTEPSVPVDASRAPDAASTPAP
AGLEPAASEPADGSRGAEASVSGTKDEGRPSSIQTPAEKTSDQAAECPEGEEDLDSKVER
LNKVLEEKREQRKKGEEKNEVRKEIERRKMGKNVQDFKRKQEEENNKRILEERNREKAEE
KAARERVRQQIAMDRADRAARYAKTLEEENAAKQARLLAMQADLEAKKEAGLRQRSAVAR
IQFRLPDGSSFTHQFSSQTRLQEAWDFAAEQVGNRYGHFSLATMFPRREFTSEDLSRTML
ELELNPSASIVVLPQLGRPPNTVFQSSGPILWTVLGSLLYPLIAVWRFLSSFFVTSASSA
SVSTNPSQHFSSHTNAPSDQTKRETPSKRSLETQPRDFKKDGKICRLRTQDDSEDDNNTW
NGNSTQQM
Download sequence
Identical sequences A0A1A8C3Z6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]