SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8GGD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8GGD2
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.16e-18
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 261-309
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000484
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8GGD2
Sequence length 341
Comment (tr|A0A1A8GGD2|A0A1A8GGD2_9TELE) Ankyrin repeat and SOCS box-containing 3 {ECO:0000313|EMBL:SBQ69459.1} OX=1143690 OS=Nothobranchius korthausae. GN=ASB3 OC=Nothobranchius.
Sequence
LLIASQEGHQACVDLLLDHGADPNVSCSQEWPQFPIHAAAQFGHISILRRLIDVTDRVCD
QSDGMVSPLYTAVHSDQTGSVELLLKEGYSPDAQECTNNLGFYSPLSVALFNATSNPGSE
SLKLLLAAGASLGSEEWTYALATDATDLLELILEHRWIPRPETLTTNHPASHRQGKLLFK
LQELRELLCVALSQVHFASRWLPVLLRTGLDPCLLLHPHMLENAESEVLNYLLEFVNWST
LSPPLKLILSQRQTEMTWRPSTNLDSIPSLSHICRLKIRQVLGPDLLMRTSIVQKLPVPS
SLHDFLRFQDIVEPSYKHPPQSPVINRVQRSQHAHQHRHVL
Download sequence
Identical sequences A0A1A8GGD2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]