SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8MWI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8MWI3
Domain Number 1 Region: 11-259
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.81e-49
Family Ankyrin repeat 0.00067
Further Details:      
 
Domain Number 2 Region: 427-476
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000876
Family SOCS box-like 0.0037
Further Details:      
 
Domain Number 3 Region: 233-322
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000304
Family Ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8MWI3
Sequence length 508
Comment (tr|A0A1A8MWI3|A0A1A8MWI3_9TELE) Ankyrin repeat and SOCS box-containing 3 {ECO:0000313|EMBL:SBR60987.1} OX=704102 OS=Nothobranchius pienaari. GN=ASB3 OC=Nothobranchius.
Sequence
MDFTECYADTVSRVAAAARSGSRRQLRRLMERGFSVDARDNRGWNALHEASAAGSKECVQ
EILSAVNCKKAVDNGHEDVVKLLVGKGAEVNRTHTSSCWTCLHQAVYKGHSDMVRVLAQF
CNLEALDDHKITALFVAAQYGQSECLEILIKAGANVNTQAADLATPLLIASQEGHQACVD
LLLDHGADPNVSCSQEWPQFPIHAAAQFGHISILRRLIDVTDRVCDQSDGMVSPLYTAVH
SDQTGSVELLLKEGYSPDAQECITNLGFYSPLSVALFNATSKPVSESLKLLLAAGASLSS
EEWTYALATDTTDLLELILEHRWIPRPETLTTNYSASHRQGKLLFKLQEVRELLCVALSQ
VHFASRWLPVLLRTGLDPCCLLLHPHMLEKAESEVLNYLLEFVNWSTLSPPLKLILNQRQ
TKMTWRPSTNLDSIPSLSHICRLKIRQVLGPDLLMRTSIVQKLPVPSSLHDFLRFQDIVE
PSYKHPPQSPVINRVQRSQRAHQHRHVL
Download sequence
Identical sequences A0A1A8MWI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]