SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8N3W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8N3W0
Domain Number 1 Region: 304-547
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-40
Family YWTD domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 166-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 3 Region: 43-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 80-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 117-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 207-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 7 Region: 247-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8N3W0
Sequence length 675
Comment (tr|A0A1A8N3W0|A0A1A8N3W0_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBR63790.1} OX=704102 OS=Nothobranchius pienaari. GN=OLA.27588 OC=Nothobranchius.
Sequence
LVAASQDSPRSMGHLGGLFLLIAPLFWSHIWGAAGHSLPACHKQLEFRCGDGVCVSKLKV
CDGHADCGDGSDERHCRHAGCKTDEFSCYSRRCISINSLCDGVDDCGDGSDEDSCPKCAT
GSFSCGMSDVCLPRNQLCDGRNDCKDGRDETRKLCGSVQPRPQSSPTSCAASEFRCRDGG
CIRHAWRCDHSPDCSDGSDEDDCDIGDQDECLVNNGGCSHYCLDQSVGFLCSCPANMKLV
GDSRCEEVDSCLESDVCDQLCVDVNNSLTCKCHEGYHMNASSGECRANGEEAQLVFTSSK
GIQLRNAESKSLAAYLPGPGPVAVVASNLTLYWAQREQGSIYRISVNKKPHEAILVVRVQ
GLVSGLAIDWIHQLLYWTSPEKGSVNVALLDGSSEVQLITGLYDPSAVAVDPLRGLLFWA
QCGGSPKVEKSSLDGSSRADVVTSLIQQPVALTLDMTRQLLYWFDQGMRSISRISLDGRH
RKTVVESNGYLDRLFGLTVFEGFLYWGDEVTGSICRANKHSGSNLQVLMSNVTSPGGVAL
LHPVLQPHGPSVCGRPGMTCQHGCVVDLRPDRLRFSCGSPETKENSQVPGIFSTAPAKTL
PDATFAGYLSLIMFLAVLLVGTALWWWREGLRPSRSLTLPSFSLKESRVPLIVQPPSGSE
ADVGPGNPSEAGLGR
Download sequence
Identical sequences A0A1A8N3W0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]