SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8Q017 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8Q017
Domain Number 1 Region: 305-548
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-40
Family YWTD domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 167-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 3 Region: 44-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 81-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 118-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 208-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 7 Region: 248-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8Q017
Sequence length 676
Comment (tr|A0A1A8Q017|A0A1A8Q017_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBR87095.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=OLA.27588 OC=Nothobranchius.
Sequence
RLVAASQVSPRSMGHLGGLFLLIAPLFWSHIWGAAGHSLPACHKQLEFRCGDGVCVSKLK
VCDGHADCGDGSDERHCRHAGCKTDEFSCYSRRCISINSLCDGVDDCGDGSDEDSCPKCA
TGSFSCGMSDVCLPRNQLCDGRNDCKDGRDETRKLCGSVQPRPQSSPTSCAASEFRCRDG
ECIRHAWRCDHSPDCSDGSDEDDCDIGDQDECRVNNGGCSHYCLDQSVGFLCSCPANMKL
VEDSRCEEVDSCLESDVCDQLCVDINNSLTCKCHEGYHMNASSGECRANGEEAQLVFTSS
KGIQLRNAESKSLAAYLPGPGPVAVVASNLTLYWAQREQGSIYRISVNEKPHEAILVVRV
QGLVSGLAIDWIHQLLYWTSPEKGSVNVALLDGSSQVQLITGLYDPSAVAVDPLRGLLFW
AQCGGNPKVEKSSLDGSSRADVVTSLIQQPVALTLDMTRQLLYWFDQGMRSISRISLDGR
HRKTVVESNGYLDRLFGLTVFEGFLYWGDEVTGSICRANKHSGSNLQVLMSNVTSPGGVA
LLHPVLQPHGPSVCGRPGMTCQHGCVVDLRPDRLRFSCGSPETKENSQDPGIFSTAPAKT
LPDATFAGYLSLIMFLAVLLVGTALWWWREGLRPSRSLTLPSFSLKESRVPLIVQPPSGS
EADVGPGNPSEAGLGR
Download sequence
Identical sequences A0A1A8Q017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]