SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8Q472 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8Q472
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.8e-20
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 272-321
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000051
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8Q472
Sequence length 353
Comment (tr|A0A1A8Q472|A0A1A8Q472_9TELE) Ankyrin repeat and SOCS box-containing 3 {ECO:0000313|EMBL:SBR88042.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=ASB3 OC=Nothobranchius.
Sequence
VNTQAADLATPLLIASQEGHQACVDLLLDHGADPNVSCSQEWPQFPIHAAAQFGHISILR
RLIDVTDRVCDQSDGMVSPLYTAVHSDQTGSVELLLKEGYSPDAQECITNLGFYSPLSVA
LFNATSKPVSESLKLLLAAGASLSSEEWTYALATDTTDLLELILEHRWIPRPETLTTNYS
ASHRQGKLLFKLQEVRELLCVALSQVHFASRWLPVLLRTGLDPCCLLLHPHMLEKAESEV
LNYLLEFVNWSTLSPPLKLILNQRQTKMTWRPSTNLDSIPSLSHICRLKIRQVLGPDLLM
RTSIVQKLPVPSSLHDFLRFQDIVEPSYKHPPQSPVINRVQRSQRAHQHRHVL
Download sequence
Identical sequences A0A1A8Q472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]