SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8RSA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8RSA3
Domain Number 1 Region: 305-548
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-40
Family YWTD domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 167-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000942
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 3 Region: 42-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 81-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 118-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000654
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 208-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000044
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 7 Region: 248-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8RSA3
Sequence length 699
Comment (tr|A0A1A8RSA3|A0A1A8RSA3_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBS08975.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=OLA.27588 OC=Nothobranchius.
Sequence
RLVAASQVSPRSMGHLGGLFLLIAPLFWSHIWGAAGHSLPACHKQLEFRCGDGVCVSKLK
VCDGHADCGDGSDERHCRHAGCKTDEFSCYSRRCISINSLCDGVDDCGDGSDEDSCPKCA
TGSFSCGMSDVCLPRNQLCDGRNDCKDGRDETRKLCGSVQPRPQSSPTSCAASEFRCRDG
ECIRHAWRCDHSPDCSDGSDEDDCDIGDQDECRVNNGGCSHYCLDQSVGFLCSCPANMKL
VEDSRCEEVDSCLESDVCDQLCVDINNSLTCKCHEGYHMNASSGECRANGEEAQLVFTSS
KGIQLRNAESKSLAAYLPGPGPVAVVASNLTLYWAQREQGSIYRISVNEKPHEAILVVRV
QGLVSGLAIDWIHQLLYWTSPEKGSVNVALLDGSSQVQLITGLYDPSAVAVDPLRGLLFW
AQCGGNPKVEKSSLDGSSRADVVTSLIQQPVALTLDMTRQLLYWFDQGMRSISRISLDGR
HRKTVVESNGYLDRLFGLTVFEGFLYWGDEVTGSICRANKHSGSNLQVLMSNVTSPGGVA
LLHPVLQPHGPSVCGRPGMTCQHGCVVDLRPDRLRFSCGSPETKENSQDPGIFSTAPAKT
LPDATFAGYLSLIMFLAVLLVGTALWWWREGLRPSRSLTLPSFSLKESRVPLIVQPPSGS
EADVGPGRWSPLRHRADVLTQGHSQLSHPRENLFLFISK
Download sequence
Identical sequences A0A1A8RSA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]