SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8U6X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8U6X5
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 8.24e-22
Family Caspase recruitment domain, CARD 0.00031
Further Details:      
 
Domain Number 2 Region: 108-189
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000334
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8U6X5
Sequence length 195
Comment (tr|A0A1A8U6X5|A0A1A8U6X5_NOTFU) CASP2 and RIPK1 domain containing adaptor with death domain {ECO:0000313|EMBL:SBS42828.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=CRADD OC=Nothobranchius.
Sequence
MERAHRAVLRKLRVEMSDQLLVSDTIVPFLYQEDILTDAQVEEIENQVTNRQKTLKLLEI
LPTRGPRAFRTFLRALQDFSWVRDRLLLELQAAPGPAEDCWIPDSDLQRIPTDRELSRLA
SRLGTEWEVVLMDLGLSAEAVFRCRSDHTLSTHSAVLAGLVQWRRAEGKKATLDWLQRSL
QGAGVHPSVLQDALA
Download sequence
Identical sequences A0A1A8U6X5
XP_015818522.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]