SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8WPD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8WPD5
Domain Number 1 Region: 61-92
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8WPD5
Sequence length 109
Comment (tr|A0A1A8WPD5|A0A1A8WPD5_PLAMA) Uncharacterized protein {ECO:0000313|EMBL:SBS93721.1} KW=Complete proteome; Reference proteome OX=5858 OS=Plasmodium malariae. GN=PMALA_040770 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MKNSVTDKGEHIIFEREHDKNKFEKKKVFLFDLSEEQKVQVENFKIRKIMQNEMYLKKNK
VLKYIIHIFLCDILKEKPDDVYEYAANYFTQPNLKQSILQKLKSMLTKS
Download sequence
Identical sequences A0A1A8WPD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]