SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8WVD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8WVD7
Domain Number 1 Region: 11-168
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000419
Family Duffy binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8WVD7
Sequence length 564
Comment (tr|A0A1A8WVD7|A0A1A8WVD7_PLAMA) STP1 protein {ECO:0000313|EMBL:SBS95834.1} KW=Complete proteome; Reference proteome OX=5858 OS=Plasmodium malariae. GN=PMALA_049610 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
YLDVKGSTFFRYVNNQKFNKIKSYIINKTKSLTNENLEENFRKGCRELANYLIQYKTAPS
YYNKDIWEGVLKGWVKHHYEKLNKHGGCPVIMTEKNLALLNFKYEVQDFCEEQNTKRKGI
LCLKRGSINEENCNEQCTIKIKEYNTWINNKKEYFNTKKAHIISTCNTAPSHFPTKQCNI
LGPTIFKTLPECKIMHLIEPSSSESKEETNDLQEKNQNTLSVPSTEENPIKENVQNSPVD
KTQSEQRTTVDQEVQLVSQPEIQELLSTGLSYTPQSTRKAQHVQDEQDTNSETPSQTESE
SPISPGTDTLQHLVSQVPRTTDSVETSSSYSESLFPSSSSVKYNGQPNLRRMFKKKKKIK
RRQVKFLRLLVPSFSNDKRELFTDDHLDYPIYYDDEIIKKITINELTKNANLTKRKNDRS
KTIIEVHMEVLEDFKNEKWENNKEKFLEICIDEFTKKKYNAYPNLTDDDLIIENIKCSND
ITKQNILWNKWIERHRNISEKLKKLHWINNLKNEWKKELAYIQEREELKIKAPNENHKVP
FIEIEKDLWKHWISKKGIIIEQYL
Download sequence
Identical sequences A0A1A8WVD7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]