SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8WW07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8WW07
Domain Number 1 Region: 114-221
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000301
Family Duffy binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8WW07
Sequence length 458
Comment (tr|A0A1A8WW07|A0A1A8WW07_PLAMA) Uncharacterized protein {ECO:0000313|EMBL:SBS96059.1} KW=Complete proteome; Reference proteome OX=5858 OS=Plasmodium malariae. GN=PMALA_050910 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MENCIPKHFALSGSAGLVLQRTQQFKTIRAHIQNKTNFLKTAKNEYLFREECKQLADFLI
KNMSPPPYTSQHMWVSLLKFHLHHYFKDITNYGGCPMILKKEHKELLELKYKEEDFCKKR
TRDFKEIERLKKTNSGKCESICLEKCKAYNAWIKEMQKQFEEKKSLFKNCYTKESPKKKS
KKQIPEPVCNILDQNTFKELSECITPNSVETTESLLETESKGLETQIQNTDQIIPKSHVQ
QETDVQVTPEHPTEIESHISQPPPEHIKSEVSEIKHSTKETEDSQSLADASLEKAKISED
VHVASEDTNESSPPTVQDMQLSPDRENTQTTDKSSIYTLAHSPPQIPHTTGTTLNPRDKY
TSSILISLFALTGMFKKKKKISRRHVKFLRLLVPSFSNKKSKIFTDDPLEHTIYDDEEII
KKIKINELKKKCKFIKANKRQIQNHSRSTYGSTRRIQK
Download sequence
Identical sequences A0A1A8WW07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]