SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8X2Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8X2Q6
Domain Number 1 Region: 116-171
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000562
Family Duffy binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8X2Q6
Sequence length 721
Comment (tr|A0A1A8X2Q6|A0A1A8X2Q6_PLAMA) STP1 protein {ECO:0000313|EMBL:SBS99522.1} KW=Complete proteome; Reference proteome OX=5858 OS=Plasmodium malariae. GN=PMALA_070900 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MENCSSRDYSGFGSGASQYLRKKEFMEALKQIPSLTASLKTKTSKNEFRGGCLKLADYLI
KIKDKPPDYTDSKRWVPVLKNYFGHKFNELSQYGGCPMIFEKKERELLVLKYDALDFCEL
NNIYVQKLSKFRKGGSSTYVCNGDPDCKKHCTEYKDWFTGKKEHFQNTKNLISESCIFKS
SSSQFPKRECNILDPKIFNKPPQCILSEPAVSSQLPPKEKVLSSSNVDQIKTEVFSAHEG
EHPSGKTSDSSPDSSPDSTLVHSPDGPPSDQSDLQTTSEGTSMENSDNLGAPTQGSLIQK
PDAHTHSLSPEKIFGSSTLQHSTGQESNTDSDTGTITASAEVLHPKPPPATPVVSKIQGK
FKKKKNIRKQIKFLRILLPSHSDKKDKFLSYDHLDQPVYDDEEIIKKLKIYEHNTIKNTN
MLRRKKERSKTIIEVHMEVLEEFRSEEWELNKGEFLAICLEIFKNEEGRYYPNLINDYQI
ENIQCNSDNEETSILWNKWIERHKNLSEKLKKEHWFNNLKNEWKKEKSKVKKMEELKNKS
SNENQKVSFLEGEKDIWRQWISNKSKIVEHYLEQDWFKGLTDEFDNILDEYENEETKNIV
SLINIEEMKHNKSCEELYIYIKKKLLSKLCILVFMTILEECKNEKNVENYESYLDSSINE
SITLENSNRKPEILEDTTEFKNDALEYRVNQEIPAYKGQNCFMLELKDWIKENDAHISFT
D
Download sequence
Identical sequences A0A1A8X2Q6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]