SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8X4R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8X4R3
Domain Number 1 Region: 16-179
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000144
Family Duffy binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8X4R3
Sequence length 363
Comment (tr|A0A1A8X4R3|A0A1A8X4R3_PLAMA) PIR Superfamily Protein {ECO:0000313|EMBL:SBS98753.1} KW=Complete proteome; Reference proteome OX=5858 OS=Plasmodium malariae. GN=PMALA_064750 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
KNVKQHITERTNYLNNENDKEKFRNACKELANYLIEKKKAPQYYSQLVWEGTLIYWLQNY
YKNLKKYGGCPMILEKEHKDILELKYEEEDFCERRSKDLQDIKQLKRNHLRTCDGKYLKK
CIEYKEWINEKKIYFEKKKNLFQGCYHKNKKKKPKSTCDILDEVTFNEPHECLSLHSEKR
CQDLSKIQGDRSQKHTEIAEKIPIPSYGQNEPLTQILPQSHKQSPDEAKSNQEGKSQHEG
NPPKEGIIHPGEQSQQQPSPNSDVPIKDVTAETPNRKPSPDIILSGSTDSDDQPLKSQET
SMLTHTSQNKSQVHSSSEKTFLTVSKPLPSPGFLPSKSSKILGINNTIYFSTFQITTLNN
TFI
Download sequence
Identical sequences A0A1A8X4R3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]