SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8X6D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8X6D6
Domain Number 1 Region: 183-459
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.29e-40
Family Duffy binding domain 0.00000976
Further Details:      
 
Domain Number 2 Region: 470-553
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000183
Family Duffy binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8X6D6
Sequence length 801
Comment (tr|A0A1A8X6D6|A0A1A8X6D6_9APIC) Duffy binding protein 2 {ECO:0000313|EMBL:SBS99778.1} KW=Complete proteome OX=864141 OS=Plasmodium ovale curtisi. GN=POVCU1_054980 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MEEIDKYGKYCADGMNDILAKEHRKNGEKKIELFVQANDKNRKGKKEKIKVIKGTKKNDK
EFNGKRTSRQLEEKDDVIGNFRDKIYTGDKYGKDNLIKNGSNSDAYDSENINNKIPTGNQ
SQKSLYDSREFVHIPDMLSSDEEHKVVATTDIHNDKIYTTTVPNYSFIDYPFLVGCKAKR
NGIWDCNKEDVNEERICIPDRRIQLCIYILMYLKHNDYSNNLKSRLLVSLNSEIILLLNK
WNVSGKFDNDAFCNDLRNDYADYGNVIKGTDMEGRDYSEEVELRFEEVFGNDDNGKRKRM
EWWYANKEDIWNNVLSLVKERANDITIEECTKEPNFEEIPQFQRWIQEWVTNSYGVRDKK
LKSLEGICEKENHSVRENGCNIGVECKKACLEYDKWKYEKKKQCYILLKKFSRVKDNEMF
IQKGSIDTISKILSKVCEEVNKVETNSTDNIYNNFCKCKASRGFFSERECKNDEECKRMC
DAYTSWIKQKIQERNALSQKFNIVKDTAKNAQGGNTENAPNFLVQVCKEFNWLDFEKIFD
LSYIIYKNVCNCKTVRNTKFFQLRMEGKKPEYTSTPSTVTYEALKLSGSKENSSNRTDSS
STTNLSRSVLDIKNSNDAHSSYNESAKNAYDKECGPGRVNTRMRFENESINTSAMGTISN
TENENVDNYPNSAHTTVHFEGNNISTSMLINRDNGNELSKFSNINNLASDGDAHKTEVNK
RSHNNYNIIDKNNESADGMKCEHYTNQNGDHSSPFATGSLKERSIVNKALTGTVIGLTNI
NKEEEKNVEKHNFSRSNTYDE
Download sequence
Identical sequences A0A1A8X6D6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]