SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8X942 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8X942
Domain Number 1 Region: 53-172
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000115
Family Duffy binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8X942
Sequence length 334
Comment (tr|A0A1A8X942|A0A1A8X942_PLAMA) PIR Superfamily Protein {ECO:0000313|EMBL:SBT00347.1} KW=Complete proteome; Reference proteome OX=5858 OS=Plasmodium malariae. GN=PMALA_075470 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
LNVLASGFFKFSPDPKFKKIIKYVIEKSSTLSKISDQETFRKGCLDLAKYLIINKSPPVY
YRDLKDMWEGAIKNWVKSHYEKLNIHGGCPVVMDENDMKILELKYEEEDFCKKRDTYLNE
IKQLKRKHLRKCNDDYLRKCSEYKVWINLKKTYFDNNRSLIQNCYNKQKPSGKSIRKKGP
ELSCDIMNQEIFNEPTDCLLSSSVVSCETSTKNKQEIEIRRTEVTNESPSMPHVKKEENT
QIAQEVQPAESEAIIQEEKPRKFQELSQLPPQEQTELPLQKPRETITNKTAVIQTENVPT
SGGHTNFESPHNSTPQGTTSYTQANKDLMTLTER
Download sequence
Identical sequences A0A1A8X942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]