SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8YPB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8YPB9
Domain Number 1 Region: 170-446
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-38
Family Duffy binding domain 0.000011
Further Details:      
 
Domain Number 2 Region: 457-540
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000262
Family Duffy binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8YPB9
Sequence length 788
Comment (tr|A0A1A8YPB9|A0A1A8YPB9_9APIC) Duffy binding protein 2 {ECO:0000313|EMBL:SBT33383.1} KW=Complete proteome; Reference proteome OX=864142 OS=Plasmodium ovale wallikeri. GN=POVWA1_016840 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MNDMLAKQHRKNGEKKIELFVRASNKNITGKKEKIREVIKGTKKNDKEFNGKRTSRQLEE
TDDVTGKFRDKIYIGDKYGRDNLIKNGSNSNAYDSENMNNKIPSNNQSQKSLYDSREFVH
MPDILSSDAEHEVVAITDIHNDKIYTTTVPNYSFIDYHFLVGCKTKRNGIWNCNKEDVNE
ERMCIPDRRIQLCIYILMYLKDNNYSNSLKIRLLVSLNSEIILLLNKWNVNGKFDNDAFC
NDLRNDYADYGDVVKGTDMDDRDYSEEVELRLKKVFGNDDNGKRKRMEWWYANKEYIWNK
TLSLVKERANDITIVECTKEPNFEEIPQFQRWIQEWFTNSYGVRDKKLKSLEGICEKENH
SVRENGCNIGVECKKACLEYDKWKYEKKKQCYILLKKFSRVKDNEMFIQKESIDTISKKL
SKVCEEVNKVETNSTDNIYNNFCKCKASMGFFSERECKNEEECKRMCNAYTSWIKQKIQE
RNALSQKFEIVKDTAKNAQGGDTENAPNFLVQVCKEFNWLDFEKIFDLSYIIYKNVCNCK
TVRNTKFFQLRMEGKKPECTSTPSTVTYEALKISGGKENSFNHTDSSSTTNLSRSVLDIK
NSSDAHSSYNESDKNAYDSERDPGTDNTRMRFENESINTSAMGTISNSEKENVDNYPNSA
HTTVHFEGNNISTNMLINRDNGNDLSKFSNINNPASDGDAQKTEVNKRSHNNYNIIDKNN
ESADGMKCKHYTNQNGDNSSPFATGSLKESSIVNKALTGTVIGLTNINKEEEKNVEKHNF
SRSNTYDE
Download sequence
Identical sequences A0A1A8YPB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]