SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9FN33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9FN33
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.19e-26
Family 7-Fe ferredoxin 0.0000965
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A9FN33
Sequence length 112
Comment (tr|A0A1A9FN33|A0A1A9FN33_9RHIZ) Ferredoxin {ECO:0000256|RuleBase:RU364098} KW=Complete proteome; Reference proteome OX=419475 OS=Ochrobactrum pseudogrignonense. GN=A8A54_09000 OC=Brucellaceae; Ochrobactrum.
Sequence
MTYVVTDNCIRCKYTDCVEVCPVDCFYEGENMLVINPDECIDCGVCEPECPAEAISPDTE
PGLDKWLELNAEYAAKWPNLTAKKDELPEAKEMDGVTGKLEQFFSAEPGSGD
Download sequence
Identical sequences A0A1A9FN33
CJA27982 WP_007876747.1.22424 WP_007876747.1.27348 WP_007876747.1.44902 WP_007876747.1.61295 WP_007876747.1.73682 281687.CJA27982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]