SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9M8U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9M8U8
Domain Number 1 Region: 218-280,311-365
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000301
Family SMI1/KNR4-like 0.016
Further Details:      
 
Domain Number 2 Region: 25-61,89-177
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000994
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A9M8U8
Sequence length 372
Comment (tr|A0A1A9M8U8|A0A1A9M8U8_9XANT) Glucan biosynthesis protein {ECO:0000313|EMBL:OAG66479.1} KW=Complete proteome OX=1843580 OS=Xanthomonas floridensis. GN=A7D17_21470 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAALKWMVYGRSPSLDTFWDEALNLGRVPATDAAIAASQARLGVRLPAWLCELYARYDGG
AVQMARGQSLEEPDNWLKAEWLISRARLLGSAELFSFAEVRAREEYRDDAFAGLAAGGDD
RHLIVIAADDRSPSRALCLDYSASDAEPTLVYVDAGNNRRLAVFANVDELLAQLVDVHYW
SPALQARHDADVVQWQPQPPAVTTFWSGAGCRNDGGAAADTDAFAAAEARLGVRLPPLFK
RLYSVQDGGDTDWCWAPRTRFPSDHYVDWECVLVDRYLTPLASIGSVLDLAAAFEDPDDF
RAAACLHAGLDRVLVLSCHNVDSLLCLDYRARGPQCEPEVVYFELWEQLVPTWRAPSFDA
FFSVLRQAELDF
Download sequence
Identical sequences A0A1A9M8U8
WP_064510028.1.1092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]