SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9V9R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9V9R9
Domain Number 1 Region: 18-129
Classification Level Classification E-value
Superfamily SH2 domain 6.73e-27
Family SH2 domain 0.0000475
Further Details:      
 
Domain Number 2 Region: 329-428
Classification Level Classification E-value
Superfamily SH2 domain 1.1e-23
Family SH2 domain 0.0000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9V9R9
Sequence length 519
Comment (tr|A0A1A9V9R9|A0A1A9V9R9_GLOAU) Uncharacterized protein {ECO:0000313|VectorBase:GAUT030372-PA} KW=Complete proteome; Reference proteome OX=7395 OS=Glossina austeni (Savannah tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MYTSPLHYSTMRPQPPGGGVSQTHDPNAEELRNAEWYWGKITREQVKNILSGKPDGSFLV
RDALSKEGEYTLTLIKDGTEKLIKICHLNGKYGFVDCKFNSVVELINYYKVNSLKLYNKT
LDITLSNPIVRPLDDDELQPNGDLRILANQFLVLHNRLNKHQQSLDQKLKIFKSIETELN
EKKLHQEVFQRAEKMFQSQIKLIETFINTQPQVGLNDNNAAISNSMRQQEQEQLQQNAAL
IKARLTDLCFEMTKLNRYVEEKKEEYKSLERQINAAKPELQSIIARKEIFTVRLKDFGIK
DEDIKQLIEMGFEAWQQRYDSVVNQPHNDESMWFLKDCSRSNAHDLLNGAPTGTFLIRAR
EAGHYALSIVCKNSINHCMIFKTESGYGFAAPYNIYHTLKKLVEHYASNSLEEHNDTLTT
TLRIPVVYWHQNKDTIMQQLQEEMEMERQQQHQVELEQQMQEHMMLPSPIVSSAPIAVTG
SAASNHGNDMAASQTPPTATPPQAHSYGSSSGGNGSSNL
Download sequence
Identical sequences A0A1A9V9R9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]