SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9VMV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9VMV6
Domain Number 1 Region: 290-360
Classification Level Classification E-value
Superfamily WWE domain 8.5e-23
Family WWE domain 0.00011
Further Details:      
 
Domain Number 2 Region: 163-283
Classification Level Classification E-value
Superfamily WWE domain 5.23e-19
Family WWE domain 0.00036
Further Details:      
 
Domain Number 3 Region: 116-165
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000471
Family RING finger domain, C3HC4 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9VMV6
Sequence length 640
Comment (tr|A0A1A9VMV6|A0A1A9VMV6_GLOAU) Uncharacterized protein {ECO:0000313|VectorBase:GAUT042092-PA} KW=Complete proteome; Reference proteome OX=7395 OS=Glossina austeni (Savannah tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MDNLEDNLTTTESSVLSSSNDVLVNHRDVAVTLDQPIDLASSHTTALSANEATTNITATL
QTSTFSAGTESPDKNATRSNKTPLDVPSTSAAAAAASAIDSASALNKDTSGTEPSAPANI
LECPICLQTCIHPARLPCGHIFCFLCVKGVAYKNRRCAMCRREIPGEFLNHPQLVNGIED
ICSTKATEDGYQWFYEGRNGGWWAYDKRSALQIEEAYQRLLQNLRVEDQSVLFDCEVITY
DIQICGNIYTIDFAHWTQYPQNMPSKERKICRAKNMPIKGVAGISNRNMNRWWQYDDRTS
QDIEEAYKKGEKSCTILVAGYVYIVDLETMIQQRQNEPSRCRHVKRDLATIPKKGVAGLR
IEGNSVITNSNFASQLYNQNRQQQLIGSTGPPDIDLRLPIEFVSHLGGDGLNTNAGISSD
FVSTTAVTDAAIRIASNIIGSTLAHADELTRPRSLNNITVFPSTPTVATRVGIDNSMDEL
DFHDLSLRSGVAGSTNSTTNYSIVSTPVSTLSNNRRLLSATVSEAAVFGRGNRELFVAAE
DLLGTTQRIIATADQPTVDLTINNFRALTLHDLVDSGDDNEDDDNNDLNNQTDHNLGNNS
VDEAENTSIMQRNRRIIDDNTENSGDGAENNIFHVRQLRF
Download sequence
Identical sequences A0A1A9VMV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]