SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9WCX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9WCX4
Domain Number 1 Region: 292-361
Classification Level Classification E-value
Superfamily WWE domain 2.49e-22
Family WWE domain 0.00013
Further Details:      
 
Domain Number 2 Region: 163-285
Classification Level Classification E-value
Superfamily WWE domain 9.29e-20
Family WWE domain 0.00035
Further Details:      
 
Domain Number 3 Region: 123-168
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000404
Family RING finger domain, C3HC4 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9WCX4
Sequence length 648
Comment (tr|A0A1A9WCX4|A0A1A9WCX4_9MUSC) Uncharacterized protein {ECO:0000313|VectorBase:GBRI014970-PA} KW=Complete proteome; Reference proteome OX=37001 OS=Glossina brevipalpis. GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MDNSKDNLTATGSSVLSSNNEALGNPRDVALTLDQPMDLTSNHTTAISASELTTNITAPL
QTSSFSAGTESADTNTTKSNKTPLDVPSTSAAAAAAVSTNDSASALNKDPNDTEPSAPAN
VLECPICLQTCIHPARLPCGHIFCFLCVKGVAYKNRRCAMCRREIPVEFLNHPQLVNGIE
GICSTKATEDGYQWFYEGRNGGWWAYDKRSALQIEEAYQRLLQNLRIEDQSVLFDCEVVT
YDIQICGNIYTIDFAHWTQYPQNMPSKERKICRAKNMPVKGVAGISNRIMNRWWQYDDRT
SQDIEEAYKKSEKSCTILVAGYVYIVDLETMIQQRQNEPSRCRRVKRDLATIPKKGVAGL
RIEGNSVLTDSNFASQLYNQNRQQQNIASTVSALSGIDLRLPLDYVSHIGRDSLSASVGS
SSEFVSTIAATDAAIRMASDIIGSTLAHTDELRRPRSLNNVLTIPGTPTVTSRVGIDNSM
GELNLHDLPLRSSVADSTNTNTNYSIISSPVSTFSNNHQLSSLSADLNEAAAFGRDSREL
LVAAEDLLGTTQRIIATVDQPTIDLFEQTINNFHALTLRNLIDSSDDNEDDDGNDLDNQI
EHNVGNNNTDEFENTPLIQRNRHIIDDNTENNEEVAGDNIFHVRQLRF
Download sequence
Identical sequences A0A1A9WCX4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]