SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9WL80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9WL80
Domain Number 1 Region: 353-623
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.73e-42
Family Eukaryotic proteases 0.00059
Further Details:      
 
Domain Number 2 Region: 157-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000117
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 28-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 73-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 121-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 245-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000181
Family Complement control module/SCR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A9WL80
Sequence length 645
Comment (tr|A0A1A9WL80|A0A1A9WL80_9MUSC) Uncharacterized protein {ECO:0000313|VectorBase:GBRI023663-PA} KW=Complete proteome; Reference proteome OX=37001 OS=Glossina brevipalpis. GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MSTYKHNVVYFGIWSVLLSTLFINEVMAQQRCGKFEWDCNDGQCVSEDARCDGVVDCQDG
SDETAENCIQGYATCHTFAFKCSYGACITGGYRCNGRKDCADNSDELICDSQKFDKLQGS
CSSDNDFQCSKSKECISKYSICDGAKDCKDGSDETLQLCVGFDCPEIAFHCGYGACINGN
AKCNGVKDCADGSDEAWELCGFPRPTNRITPSQPPDSQNENKCQLPENGLYLVARLHPQN
HTIRLGSWVNNYETIHLECSNGYRIPTGASLNCQDGKWKGSFPTCAQYCEGQALLGLSTF
YVCFNNNIPARQCQRVQPNAQVYIGCNAGYDGLGNNLPPLRCTSDGKFTAKRPTCGVECG
VLRLGTALARKGLPVEKSEVPWQVAIYQKPSDNVNYKFICGGSIISPSVIVTAQFVQKIY
RVFKTFTEAAHCFWDVAIEQKMNAEFFQIAAGKYYRDYGVTKDPTAQIADVAEIVISSSF
RYDKDHFREDIAVVKLKNPFIFNENISAVCLTIKSSADRYVPNNWDGSVVGYGDTDDKVL
QQVPMKTLSYHSCQLKDKLAFLANDKFCVQNEGEATVCRGDSGGGYVIHSAITKRHELWG
IISYTPFRNAECARDGFVTVTNVNYMSDEVILKMEQFKQEDKTLF
Download sequence
Identical sequences A0A1A9WL80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]