SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9Y6P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9Y6P6
Domain Number 1 Region: 333-584
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.85e-47
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 898-1175
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.77e-42
Family Eukaryotic proteases 0.00057
Further Details:      
 
Domain Number 3 Region: 21-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 722-762
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 152-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 587-625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 67-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 632-668
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 215-279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000792
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 10 Region: 116-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 11 Region: 805-844
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000834
Family Complement control module/SCR domain 0.0053
Further Details:      
 
Domain Number 12 Region: 680-718
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000122
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9Y6P6
Sequence length 1186
Comment (tr|A0A1A9Y6P6|A0A1A9Y6P6_GLOFF) Uncharacterized protein {ECO:0000313|VectorBase:GFUI033471-PA} KW=Complete proteome; Reference proteome OX=201502 OS=Glossina fuscipes fuscipes (Riverine tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MRHNNSNYVIIKKSDDIEKMIAQQQCGTSQWDCNNGQCISGNARCDGMVDCQDGSDETAE
NCIQGYATCHAFGFKCAYGACVAASHRCNGRKDCADNSDELVCNDKKPDKLQGNCSSGTD
FECSQSKECISKANMCNGIKDCTDGSDETLQLCVGSDCPDGAFPCGYGACISGTAKCNGV
KDCADGSDEAWELCGYPRPVNKATSSLSDTRDENRCQLPENYPHLVARLHPQNETIPLGA
WVGNYEIVHLECSNGYRITTDDSLNCQNGKWTAAFPTCAEYCDGLSLLGLSTFYVCINNF
MAARQCTRVQPNTEIIVGCKVGYEGFGNMSPLIRCTSDGKFTSKRPTCNVECGVLRQGTP
LTREGLQVQRNEVPWQVSIYRKPDKTNYKFVCGGSIISPSVIVTAAHCFWDVAVQEKMNA
DAFQVAAGKYYRDYDMAKDPTAQISDIAEIAISPSFQYGKDKILEDIAVVKLKTPFVFNE
NISAVCLRFDARANSYVPNDWAGTIVGYGDTDTEYKAIQRVPMKSLSFHSCQLRQQANLA
DDKFCLQNEDRATVCRGDSGGGFVIQNAVTKRHELLGVISYTRFSMAQLQCETFQWNCDD
GQCISDSGRCDGVVDCQDGSDETAENCIQVHSTCHTFAFKCAYGACIANGYRCNGRKDCA
DNSDELICDESKFDKLQGSCRSDTEFECTRLKECISKVNICNGAKDCKDGSDETLELCAG
FDCSDGMFHCGYGACINRTATCNGVKDCLDGSDEAWELCGFPRPRNKLTPSLADLRNENK
CQLPENGPYLLARLHPQNQTIRLGRWVDNYETIHLECSNGYRIPTHASLNCQNGKWTRGF
PSCVQYCDGQSLRGLSTFHVCINNGIAARQCQRLQPKTAVIIRCNVGYEGLSDSAPIMRC
NLDGKFTAKRPTCNVECGVQRTSARFRRDLGFTIDQSEAPWQVAIYQKPDNVSYRLICSG
SIISPSIIVTAAHCFWDVAVEQTISAEFFQVAAGKYYRDYDMAKDPTAQIADVAEIVISS
SFQYNKNDFVEDIAVVKLKTPFVFNENVSAVCFDFGTRASRYVPNNLVGSIVGYGDTGEV
LELLPMKTLSYHNCQLKDKYANLAGDKFCLQNEGEAILCRGDRGGGYVIQNPVTKRYELL
GVISLTPFLNHECAREEVVTATNVKYMSNEIREKLEQFKQEDKALF
Download sequence
Identical sequences A0A1A9Y6P6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]