SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9Z8M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9Z8M0
Domain Number 1 Region: 826-993
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.44e-44
Family Lysophospholipase 0.087
Further Details:      
 
Domain Number 2 Region: 101-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.73e-23
Family cAMP-binding domain 0.01
Further Details:      
 
Domain Number 3 Region: 504-613
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.03e-21
Family cAMP-binding domain 0.0084
Further Details:      
 
Domain Number 4 Region: 996-1161
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.66e-19
Family Lysophospholipase 0.077
Further Details:      
 
Domain Number 5 Region: 365-498
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000017
Family cAMP-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A9Z8M0
Sequence length 1338
Comment (tr|A0A1A9Z8M0|A0A1A9Z8M0_GLOPL) Uncharacterized protein {ECO:0000313|VectorBase:GPAI007063-PA} KW=Complete proteome; Reference proteome OX=7398 OS=Glossina pallidipes (Tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MLFAQSSLAAATGDIRGLRFRKRDKMLFYGRRMLRKVKNVSGQMYGGQGRKRKAVMRFAK
RLLQLRREKIPLQMRTVEPPAEYLEETMEGSDRVPPDALYMLQSIRIFGHFEKPIFLKLC
KHTEVLTLEPGDYLFKITDADDSVFIVQSGLVNVSISNADGSTLSLKTVRKGESVTSLLS
FVDVLSGNSSYYKTVTAKAMEKSIVIRLPMQAFQEVFHENPDIMIRVIQVIMIRLQRVLF
TALRNYLGLNSELVQNHMRPKKNHNTPANVAQQQNQPKSSPSHRRTDSTPTQVHSLSEMA
IPPPDMLVDLAYEHLNSSAHSHAHAGSLSTRKYSIIPAECLVNASSFDMQLVYASAVESY
LKELGLNEDDRALLEQLVEVKEIDADATLITEGDSENVCIFFVMTGCLTVHQIGSNPVRV
VKGDKPEVFIHHVHPGEIVGALAVLTGEASAYTIKSLCSSRVALLTRSAIYQLMRERPKI
VLDLGNSVVRRLSPLVRQCDYALDWIFLESGRAVYRQDEMSDSTYIVLSGRMRSVITQAN
GKKEIVGEYGKGDLVGIIEMITETGRTTTVMAVRDSELAKLPEGLFNAIKLRYPIVVTKL
ISLLSHRILGTMQTRSGSTAAPLEANPVTHKYSTVALVPVNDEVPLTAFTYELFHSLCAI
GPTLRLTSEVIRKQLGVQIFEQSNEYRLTSWLAQQEDRNTITLYQCDASLSAWTQRCMRQ
ADVILIVGLGDGPSSVGKFEREIDRLAMRTQKELVLLYSETDSSKPLNTLQWLNVRPWVT
KHHHIQCVKRMFSRKSQYRINDLYSRVLMSEPNMHSDFSRLARWLTGNSIGLVLGGGGAR
GAAHIGMLKAIQEAGIPIDMVGGVSIGALMGALWCAERNITTVTQQAREWCKKMTKWFLQ
LLDLTYPITSMFSGREFNKTIRDTIGDVSIEDLWIPFFTLTTDITASCRRIHTNGSLWRY
VRSSMSLSGYMPPLCDPKDGHLLLDGGYINNLPGHLWRYIRASMSIAGVLPPFCDYKDGH
LLLDGCYINNVPADVMHKLGAAHIIAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTTP
VRVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLAFGSFDEIRDVGYVYG
KNYFENMAKAGRLGRFNQWFNKDPPTKDYHALREYSFIDLAQIVCKLPETSVDPQQFQMN
YVYSEDEDYDGYISEPSTYNRNQIKMKRTGTSLSLSENEMDSDIELDLTLDLRNNQSKTL
MPISLSKISIDTIEGQLPLTKSVNLIGESTNHHRSSLETNTKVKQQRGSGFPEQQLHQQR
QDPQQNDVENESTNRGQS
Download sequence
Identical sequences A0A1A9Z8M0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]