SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9ZF38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9ZF38
Domain Number 1 Region: 57-153
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 5.75e-38
Family Chemosensory protein Csp2 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A9ZF38
Sequence length 178
Comment (tr|A0A1A9ZF38|A0A1A9ZF38_GLOPL) Chemosensory protein 2 {ECO:0000313|VectorBase:GPAI012674-PA} KW=Complete proteome; Reference proteome OX=7398 OS=Glossina pallidipes (Tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MLISFVRIPQIDKKFLIINNMLRFFGICIVTAIIAWDSVGSLPHPPATTAAPFKQSYDNK
FDNVDLDEILGQERLLKNYVKCLEGTGPCTPDGKMLKETIPDAMATDCAKCTPKQKYGSE
KVTHFLIDNRPEDWERLEKIYDPAGTYRTAYLTGKGEKKKTNLIITTTERNNDSIPNA
Download sequence
Identical sequences A0A1A9ZF38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]