SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9ZHK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9ZHK6
Domain Number 1 Region: 328-595
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.46e-42
Family Eukaryotic proteases 0.00079
Further Details:      
 
Domain Number 2 Region: 151-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 17-57
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 4 Region: 58-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 233-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000208
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 6 Region: 109-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000825
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A9ZHK6
Sequence length 615
Comment (tr|A0A1A9ZHK6|A0A1A9ZHK6_GLOPL) Uncharacterized protein {ECO:0000313|VectorBase:GPAI014857-PA} KW=Complete proteome; Reference proteome OX=7398 OS=Glossina pallidipes (Tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MCCVLMKILFVNEGMAQQQCETFQWNCDDGQCISDSGRCDGVVDCQDGSDETPENCIQVY
STCHAFAFKCAYGACIANGYRCNGRKDCADNSDELVCDESKFDKLQGSCSSDAEFECTRL
KECISKANICNGAKDCKDGSDETLELCAGFDCADGAFHCGYGACINRTATCNGVKDCLDG
SDEAWELCGFPRPRNKLTPSLSDLRNENKCQLPENGPYLLAHLHPQNQTIRLGRWVENYE
TIHLECSNGYRIPSHASLNCQNGKWTRGFPSCVQYCDGQSLRGLSTFHVCINNGIAARQC
QRLQPKSAVIIRCNVGYEGLSDNAPIMRCNLDGKFTAKRPTCNVECGVQRTSARFRRDLG
FVIEQSEAPWQVAIYQKPDNVSYRLICSGSIISPSIIVTAAHCFWDVAVEQTINAEFFQV
AAGKYYRDYDMAKDPTAQVADVAEIVISSSFQYNKNAFLEDIAVVKLKTPFIFNENVSAV
CFDFGTRASRYVPNNLVGSIVGYGGTGEVLELLPMKSLSYHNCQLKESYANLAGDKFCLQ
NEGEAIICRGDRGGGYVIQNPVTKRYELLGVISLTPFLNHECAREEVVTATNVKYMSNEV
REKLEQFKQEDKALF
Download sequence
Identical sequences A0A1A9ZHK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]