SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0G7Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0G7Z9
Domain Number 1 Region: 319-586
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.45e-41
Family Eukaryotic proteases 0.00069
Further Details:      
 
Domain Number 2 Region: 142-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 7-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 49-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 224-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000264
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 6 Region: 100-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B0G7Z9
Sequence length 607
Comment (tr|A0A1B0G7Z9|A0A1B0G7Z9_GLOMM) Uncharacterized protein {ECO:0000313|VectorBase:GMOY009438-PA} KW=Complete proteome; Reference proteome OX=37546 OS=Glossina morsitans morsitans (Savannah tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MICLSMAQQQCETFQWNCDDGQCISDSGRCDGVVDCQDGSDETPENCIQVYSTCHAFAFK
CAYGACIANGYRCNGRKDCADNSDELVCDESKFDKLQGSCSSDTEFECTRLKECISKVNI
CNGAKDCKDGSDETLELCAGFDCSDGAFHCGYGACINRTATCNGVKDCIDGSDEAWELCG
FPRPKNKLTPSLSDLRNENKCQLPENGPYLLAHLHPQNQTIRLGRWVENYETIHLECSNG
YRIPTQASLNCQNGKWTRGFPSCVQYCDGQSLRGLSTFHVCINNGIAARQCQRVQPKTAV
IIRCNVGYEGLSDNAPIMRCNLDGKFTAKRPTCNVECGVQRTSSRFRRDLGFVIEQSEAP
WQVAIYQKPDNISYRLICSGSIISPSIIVTAAHCFWDVAVEQTISAEFFQVAAGKYYRDY
DMAKDPTAQVADVAEIVISSSFQYNKNAFLEDIAVVKLKTPFIFNENVSAVCFDFGTRAS
RYVPNNLVGAIVGYGGTGEVLELLPMKSLSYHNCQLKDTYANLAGDKFCLQNEGEAILCR
GDRGGGYVIQNPITKRYELLGVISLTPYLNHECAREEVVTATNVKYMSNEVREKLEQFKQ
DDKAFKK
Download sequence
Identical sequences A0A1B0G7Z9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]