SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1EFX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1EFX3
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-38
Family Thioltransferase 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B1EFX3
Sequence length 108
Comment (tr|A0A1B1EFX3|A0A1B1EFX3_VIBNA) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome OX=691 OS=Vibrio natriegens. GN=BA894_15205 OC=Vibrionaceae; Vibrio.
Sequence
MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEVAEEYEGKLTIGKLN
IDHNAGTPPKFGIRGIPTLLLFKDGNVAATKVGALSKTQLKEFLDANI
Download sequence
Identical sequences A0A1B1EFX3 H2IFH0
WP_014233348.1.13071 WP_014233348.1.14200 WP_014233348.1.16983 WP_014233348.1.18931 WP_014233348.1.37005 WP_014233348.1.50333 WP_014233348.1.59672 WP_014233348.1.84506 WP_014233348.1.88247 gi|375267031|ref|YP_005024474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]