SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1EKP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1EKP3
Domain Number 1 Region: 82-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.9e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B1EKP3
Sequence length 204
Comment (tr|A0A1B1EKP3|A0A1B1EKP3_VIBNA) Glutathione S-transferase {ECO:0000313|EMBL:ANQ29094.1} KW=Complete proteome OX=691 OS=Vibrio natriegens. GN=BA894_22125 OC=Vibrionaceae; Vibrio.
Sequence
MKLYETAMTPSCKRVNIFLKEIGGDVERVAINVRDGDNLTDSFKQKSVNGKVPVLEFDDG
TTICESVAICRYFDEEFSNDLNLFGGNQRERAQVEMWHRVVEFQGLYAAFQAFRNISAIY
KDRENCVKEWGEESKSRVLEFLPVLDKRLAESEFIATDRFTIVDITGYLFVGFAINALQI
DVLSTAPNIARWFEKISAREAFQS
Download sequence
Identical sequences A0A1B1EKP3 H2ILR4
WP_014234309.1.13071 WP_014234309.1.88247 gi|375263210|ref|YP_005025440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]